libedlib →
1.2.7-4 →
armhf → 2022-12-03 16:47:00
sbuild (Debian sbuild) 0.72.0 (25 Oct 2016) on mb-lxc-02
+==============================================================================+
| libedlib 1.2.7-4 (armhf) Sat, 03 Dec 2022 16:34:53 +0000 |
+==============================================================================+
Package: libedlib
Version: 1.2.7-4
Source Version: 1.2.7-4
Distribution: bookworm-staging
Machine Architecture: armhf
Host Architecture: armhf
Build Architecture: armhf
I: NOTICE: Log filtering will replace 'var/lib/schroot/mount/bookworm-staging-armhf-sbuild-037c9058-a5df-4944-af2f-44af7b40c4ea' with '<<CHROOT>>'
+------------------------------------------------------------------------------+
| Update chroot |
+------------------------------------------------------------------------------+
Get:1 http://172.17.4.1/private bookworm-staging InRelease [11.3 kB]
Get:2 http://172.17.4.1/private bookworm-staging/main Sources [13.4 MB]
Get:3 http://172.17.4.1/private bookworm-staging/main armhf Packages [14.3 MB]
Fetched 27.7 MB in 11s (2554 kB/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
W: http://172.17.4.1/private/dists/bookworm-staging/InRelease: Key is stored in legacy trusted.gpg keyring (/etc/apt/trusted.gpg), see the DEPRECATION section in apt-key(8) for details.
+------------------------------------------------------------------------------+
| Fetch source files |
+------------------------------------------------------------------------------+
Check APT
---------
Checking available source versions...
Download source files with APT
------------------------------
Reading package lists...
NOTICE: 'libedlib' packaging is maintained in the 'Git' version control system at:
https://salsa.debian.org/med-team/libedlib.git
Please use:
git clone https://salsa.debian.org/med-team/libedlib.git
to retrieve the latest (possibly unreleased) updates to the package.
Need to get 4329 kB of source archives.
Get:1 http://172.17.4.1/private bookworm-staging/main libedlib 1.2.7-4 (dsc) [2221 B]
Get:2 http://172.17.4.1/private bookworm-staging/main libedlib 1.2.7-4 (tar) [4319 kB]
Get:3 http://172.17.4.1/private bookworm-staging/main libedlib 1.2.7-4 (diff) [7316 B]
Fetched 4329 kB in 1s (6665 kB/s)
Download complete and in download only mode
I: NOTICE: Log filtering will replace 'build/libedlib-oM9Uv6/libedlib-1.2.7' with '<<PKGBUILDDIR>>'
I: NOTICE: Log filtering will replace 'build/libedlib-oM9Uv6' with '<<BUILDDIR>>'
+------------------------------------------------------------------------------+
| Install build-essential |
+------------------------------------------------------------------------------+
Setup apt archive
-----------------
Merged Build-Depends: build-essential, fakeroot
Filtered Build-Depends: build-essential, fakeroot
dpkg-deb: building package 'sbuild-build-depends-core-dummy' in '/<<BUILDDIR>>/resolver-f9qWZK/apt_archive/sbuild-build-depends-core-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning: sbuild-build-depends-core-dummy
dpkg-scanpackages: info: Wrote 1 entries to output Packages file.
gpg: keybox '/<<BUILDDIR>>/resolver-f9qWZK/gpg/pubring.kbx' created
gpg: /<<BUILDDIR>>/resolver-f9qWZK/gpg/trustdb.gpg: trustdb created
gpg: key 37145E60F90AF620: public key "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" imported
gpg: Total number processed: 1
gpg: imported: 1
gpg: key 37145E60F90AF620: "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" not changed
gpg: key 37145E60F90AF620: secret key imported
gpg: Total number processed: 1
gpg: unchanged: 1
gpg: secret keys read: 1
gpg: secret keys imported: 1
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ Release [957 B]
Get:3 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ Sources [349 B]
Get:5 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ Packages [431 B]
Fetched 2107 B in 1s (3804 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...
Install core build dependencies (apt-based resolver)
----------------------------------------------------
Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
krb5-locales libpam-cap libperl5.34 netbase perl-modules-5.34 sensible-utils
Use 'apt autoremove' to remove them.
The following NEW packages will be installed:
sbuild-build-depends-core-dummy
0 upgraded, 1 newly installed, 0 to remove and 80 not upgraded.
Need to get 852 B of archives.
After this operation, 0 B of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ sbuild-build-depends-core-dummy 0.invalid.0 [852 B]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 852 B in 0s (66.5 kB/s)
Selecting previously unselected package sbuild-build-depends-core-dummy.
(Reading database ... 14774 files and directories currently installed.)
Preparing to unpack .../sbuild-build-depends-core-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-core-dummy (0.invalid.0) ...
Setting up sbuild-build-depends-core-dummy (0.invalid.0) ...
W: No sandbox user '_apt' on the system, can not drop privileges
+------------------------------------------------------------------------------+
| Check architectures |
+------------------------------------------------------------------------------+
Arch check ok (armhf included in any)
+------------------------------------------------------------------------------+
| Install package build dependencies |
+------------------------------------------------------------------------------+
Setup apt archive
-----------------
Merged Build-Depends: debhelper-compat (= 13), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools
Filtered Build-Depends: debhelper-compat (= 13), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools
dpkg-deb: building package 'sbuild-build-depends-libedlib-dummy' in '/<<BUILDDIR>>/resolver-f9qWZK/apt_archive/sbuild-build-depends-libedlib-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning: sbuild-build-depends-core-dummy sbuild-build-depends-libedlib-dummy
dpkg-scanpackages: info: Wrote 2 entries to output Packages file.
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ Release [963 B]
Get:3 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ Sources [537 B]
Get:5 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ Packages [617 B]
Fetched 2487 B in 1s (4645 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...
Install libedlib build dependencies (apt-based resolver)
--------------------------------------------------------
Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
krb5-locales libpam-cap libperl5.34 netbase perl-modules-5.34
Use 'apt autoremove' to remove them.
The following additional packages will be installed:
autoconf automake autopoint autotools-dev bsdextrautils bsdutils cmake
cmake-data cython3 d-shlibs debhelper dh-autoreconf dh-python
dh-strip-nondeterminism dwz file gettext gettext-base groff-base
intltool-debian libarchive-zip-perl libarchive13 libblkid1 libbrotli1
libcurl4 libdebhelper-perl libelf1 libexpat1 libexpat1-dev
libfile-stripnondeterminism-perl libicu72 libjs-jquery libjs-sphinxdoc
libjs-underscore libjsoncpp25 libmagic-mgc libmagic1 libmount1 libmpdec3
libncurses6 libnghttp2-14 libpipeline1 libprocps8 libpsl5 libpython3-all-dev
libpython3-dev libpython3-stdlib libpython3.10 libpython3.10-dev
libpython3.10-minimal libpython3.10-stdlib librhash0 librtmp1 libsmartcols1
libssh2-1 libsub-override-perl libtool libuchardet0 libuuid1 libuv1 libxml2
m4 man-db media-types mount po-debconf procps python3 python3-all
python3-all-dev python3-dev python3-distutils python3-lib2to3
python3-minimal python3-pkg-resources python3-setuptools python3.10
python3.10-dev python3.10-minimal rename util-linux util-linux-extra
zlib1g-dev
Suggested packages:
autoconf-archive gnu-standards autoconf-doc cmake-doc cmake-format
elpa-cmake-mode ninja-build cython-doc dh-make flit python3-build
python3-tomli python3-installer gettext-doc libasprintf-dev libgettextpo-dev
groff lrzip cryptsetup-bin libtool-doc gfortran | fortran95-compiler gcj-jdk
m4-doc apparmor less www-browser nfs-common libmail-box-perl python3-doc
python3-tk python3-venv python-setuptools-doc python3.10-venv python3.10-doc
binfmt-support dosfstools kbd util-linux-locales
Recommended packages:
curl | wget | lynx ca-certificates libarchive-cpio-perl javascript-common
libgpm2 publicsuffix libltdl-dev uuid-runtime libmail-sendmail-perl psmisc
The following NEW packages will be installed:
autoconf automake autopoint autotools-dev bsdextrautils cmake cmake-data
cython3 d-shlibs debhelper dh-autoreconf dh-python dh-strip-nondeterminism
dwz file gettext gettext-base groff-base intltool-debian libarchive-zip-perl
libarchive13 libbrotli1 libcurl4 libdebhelper-perl libelf1 libexpat1
libexpat1-dev libfile-stripnondeterminism-perl libicu72 libjs-jquery
libjs-sphinxdoc libjs-underscore libjsoncpp25 libmagic-mgc libmagic1
libmpdec3 libncurses6 libnghttp2-14 libpipeline1 libprocps8 libpsl5
libpython3-all-dev libpython3-dev libpython3-stdlib libpython3.10
libpython3.10-dev libpython3.10-minimal libpython3.10-stdlib librhash0
librtmp1 libssh2-1 libsub-override-perl libtool libuchardet0 libuv1 libxml2
m4 man-db media-types po-debconf procps python3 python3-all python3-all-dev
python3-dev python3-distutils python3-lib2to3 python3-minimal
python3-pkg-resources python3-setuptools python3.10 python3.10-dev
python3.10-minimal rename sbuild-build-depends-libedlib-dummy zlib1g-dev
The following packages will be upgraded:
bsdutils libblkid1 libmount1 libsmartcols1 libuuid1 mount util-linux
util-linux-extra
8 upgraded, 76 newly installed, 0 to remove and 72 not upgraded.
Need to get 40.6 MB of archives.
After this operation, 167 MB of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-f9qWZK/apt_archive ./ sbuild-build-depends-libedlib-dummy 0.invalid.0 [904 B]
Get:2 http://172.17.4.1/private bookworm-staging/main armhf bsdutils armhf 1:2.38.1-4 [83.9 kB]
Get:3 http://172.17.4.1/private bookworm-staging/main armhf libsmartcols1 armhf 2.38.1-4 [91.6 kB]
Get:4 http://172.17.4.1/private bookworm-staging/main armhf util-linux-extra armhf 2.38.1-4 [98.1 kB]
Get:5 http://172.17.4.1/private bookworm-staging/main armhf util-linux armhf 2.38.1-4 [1062 kB]
Get:6 http://172.17.4.1/private bookworm-staging/main armhf mount armhf 2.38.1-4 [126 kB]
Get:7 http://172.17.4.1/private bookworm-staging/main armhf libpython3.10-minimal armhf 3.10.8-3 [769 kB]
Get:8 http://172.17.4.1/private bookworm-staging/main armhf libexpat1 armhf 2.5.0-1 [77.2 kB]
Get:9 http://172.17.4.1/private bookworm-staging/main armhf python3.10-minimal armhf 3.10.8-3 [1478 kB]
Get:10 http://172.17.4.1/private bookworm-staging/main armhf python3-minimal armhf 3.10.6-1 [38.7 kB]
Get:11 http://172.17.4.1/private bookworm-staging/main armhf media-types all 8.0.0 [33.4 kB]
Get:12 http://172.17.4.1/private bookworm-staging/main armhf libmpdec3 armhf 2.5.1-2+rpi1 [73.5 kB]
Get:13 http://172.17.4.1/private bookworm-staging/main armhf libuuid1 armhf 2.38.1-4 [27.1 kB]
Get:14 http://172.17.4.1/private bookworm-staging/main armhf libpython3.10-stdlib armhf 3.10.8-3 [1597 kB]
Get:15 http://172.17.4.1/private bookworm-staging/main armhf python3.10 armhf 3.10.8-3 [506 kB]
Get:16 http://172.17.4.1/private bookworm-staging/main armhf libpython3-stdlib armhf 3.10.6-1 [21.7 kB]
Get:17 http://172.17.4.1/private bookworm-staging/main armhf python3 armhf 3.10.6-1 [38.2 kB]
Get:18 http://172.17.4.1/private bookworm-staging/main armhf libblkid1 armhf 2.38.1-4 [131 kB]
Get:19 http://172.17.4.1/private bookworm-staging/main armhf libmount1 armhf 2.38.1-4 [144 kB]
Get:20 http://172.17.4.1/private bookworm-staging/main armhf libuchardet0 armhf 0.0.7-1 [65.0 kB]
Get:21 http://172.17.4.1/private bookworm-staging/main armhf groff-base armhf 1.22.4-9 [774 kB]
Get:22 http://172.17.4.1/private bookworm-staging/main armhf bsdextrautils armhf 2.38.1-4 [78.8 kB]
Get:23 http://172.17.4.1/private bookworm-staging/main armhf libpipeline1 armhf 1.5.7-1 [33.4 kB]
Get:24 http://172.17.4.1/private bookworm-staging/main armhf man-db armhf 2.11.1-1 [1341 kB]
Get:25 http://172.17.4.1/private bookworm-staging/main armhf libncurses6 armhf 6.3+20220423-2 [79.6 kB]
Get:26 http://172.17.4.1/private bookworm-staging/main armhf libprocps8 armhf 2:3.3.17-7.1 [41.9 kB]
Get:27 http://172.17.4.1/private bookworm-staging/main armhf procps armhf 2:3.3.17-7.1 [457 kB]
Get:28 http://172.17.4.1/private bookworm-staging/main armhf libmagic-mgc armhf 1:5.41-4 [295 kB]
Get:29 http://172.17.4.1/private bookworm-staging/main armhf libmagic1 armhf 1:5.41-4 [120 kB]
Get:30 http://172.17.4.1/private bookworm-staging/main armhf file armhf 1:5.41-4 [65.8 kB]
Get:31 http://172.17.4.1/private bookworm-staging/main armhf gettext-base armhf 0.21-10 [156 kB]
Get:32 http://172.17.4.1/private bookworm-staging/main armhf m4 armhf 1.4.19-1 [260 kB]
Get:33 http://172.17.4.1/private bookworm-staging/main armhf autoconf all 2.71-2 [343 kB]
Get:34 http://172.17.4.1/private bookworm-staging/main armhf autotools-dev all 20220109.1 [51.6 kB]
Get:35 http://172.17.4.1/private bookworm-staging/main armhf automake all 1:1.16.5-1.3 [823 kB]
Get:36 http://172.17.4.1/private bookworm-staging/main armhf autopoint all 0.21-10 [495 kB]
Get:37 http://172.17.4.1/private bookworm-staging/main armhf libicu72 armhf 72.1-3 [9009 kB]
Get:38 http://172.17.4.1/private bookworm-staging/main armhf libxml2 armhf 2.9.14+dfsg-1.1 [570 kB]
Get:39 http://172.17.4.1/private bookworm-staging/main armhf libarchive13 armhf 3.6.0-1 [306 kB]
Get:40 http://172.17.4.1/private bookworm-staging/main armhf libbrotli1 armhf 1.0.9-2+b2 [260 kB]
Get:41 http://172.17.4.1/private bookworm-staging/main armhf libnghttp2-14 armhf 1.50.0-1 [65.0 kB]
Get:42 http://172.17.4.1/private bookworm-staging/main armhf libpsl5 armhf 0.21.0-1.2 [56.2 kB]
Get:43 http://172.17.4.1/private bookworm-staging/main armhf librtmp1 armhf 2.4+20151223.gitfa8646d.1-2+b2 [54.2 kB]
Get:44 http://172.17.4.1/private bookworm-staging/main armhf libssh2-1 armhf 1.10.0-3+b1 [161 kB]
Get:45 http://172.17.4.1/private bookworm-staging/main armhf libcurl4 armhf 7.86.0-2 [322 kB]
Get:46 http://172.17.4.1/private bookworm-staging/main armhf libjsoncpp25 armhf 1.9.5-4 [66.7 kB]
Get:47 http://172.17.4.1/private bookworm-staging/main armhf librhash0 armhf 1.4.3-3 [142 kB]
Get:48 http://172.17.4.1/private bookworm-staging/main armhf libuv1 armhf 1.44.2-1+rpi1 [125 kB]
Get:49 http://172.17.4.1/private bookworm-staging/main armhf cmake-data all 3.25.1-1 [2026 kB]
Get:50 http://172.17.4.1/private bookworm-staging/main armhf cmake armhf 3.25.1-1 [3859 kB]
Get:51 http://172.17.4.1/private bookworm-staging/main armhf cython3 armhf 0.29.32-2 [1218 kB]
Get:52 http://172.17.4.1/private bookworm-staging/main armhf d-shlibs all 0.104 [18.6 kB]
Get:53 http://172.17.4.1/private bookworm-staging/main armhf libdebhelper-perl all 13.11.1 [80.8 kB]
Get:54 http://172.17.4.1/private bookworm-staging/main armhf libtool all 2.4.7-5 [517 kB]
Get:55 http://172.17.4.1/private bookworm-staging/main armhf dh-autoreconf all 20 [17.1 kB]
Get:56 http://172.17.4.1/private bookworm-staging/main armhf libarchive-zip-perl all 1.68-1 [104 kB]
Get:57 http://172.17.4.1/private bookworm-staging/main armhf libsub-override-perl all 0.09-4 [9304 B]
Get:58 http://172.17.4.1/private bookworm-staging/main armhf libfile-stripnondeterminism-perl all 1.13.0-2 [19.4 kB]
Get:59 http://172.17.4.1/private bookworm-staging/main armhf dh-strip-nondeterminism all 1.13.0-2 [8556 B]
Get:60 http://172.17.4.1/private bookworm-staging/main armhf libelf1 armhf 0.187-2+rpi2 [177 kB]
Get:61 http://172.17.4.1/private bookworm-staging/main armhf dwz armhf 0.14+20220924-2 [93.1 kB]
Get:62 http://172.17.4.1/private bookworm-staging/main armhf gettext armhf 0.21-10 [1203 kB]
Get:63 http://172.17.4.1/private bookworm-staging/main armhf intltool-debian all 0.35.0+20060710.6 [22.9 kB]
Get:64 http://172.17.4.1/private bookworm-staging/main armhf po-debconf all 1.0.21+nmu1 [248 kB]
Get:65 http://172.17.4.1/private bookworm-staging/main armhf debhelper all 13.11.1 [941 kB]
Get:66 http://172.17.4.1/private bookworm-staging/main armhf python3-lib2to3 all 3.10.8-1 [77.3 kB]
Get:67 http://172.17.4.1/private bookworm-staging/main armhf python3-distutils all 3.10.8-1 [139 kB]
Get:68 http://172.17.4.1/private bookworm-staging/main armhf dh-python all 5.20220819+rpi1 [114 kB]
Get:69 http://172.17.4.1/private bookworm-staging/main armhf libexpat1-dev armhf 2.5.0-1 [130 kB]
Get:70 http://172.17.4.1/private bookworm-staging/main armhf libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB]
Get:71 http://172.17.4.1/private bookworm-staging/main armhf libjs-underscore all 1.13.4~dfsg+~1.11.4-2 [116 kB]
Get:72 http://172.17.4.1/private bookworm-staging/main armhf libjs-sphinxdoc all 4.5.0-4 [142 kB]
Get:73 http://172.17.4.1/private bookworm-staging/main armhf libpython3.10 armhf 3.10.8-3 [1458 kB]
Get:74 http://172.17.4.1/private bookworm-staging/main armhf zlib1g-dev armhf 1:1.2.11.dfsg-4.1 [183 kB]
Get:75 http://172.17.4.1/private bookworm-staging/main armhf libpython3.10-dev armhf 3.10.8-3 [2935 kB]
Get:76 http://172.17.4.1/private bookworm-staging/main armhf libpython3-dev armhf 3.10.6-1 [22.0 kB]
Get:77 http://172.17.4.1/private bookworm-staging/main armhf libpython3-all-dev armhf 3.10.6-1 [1068 B]
Get:78 http://172.17.4.1/private bookworm-staging/main armhf python3-all armhf 3.10.6-1 [1060 B]
Get:79 http://172.17.4.1/private bookworm-staging/main armhf python3.10-dev armhf 3.10.8-3 [509 kB]
Get:80 http://172.17.4.1/private bookworm-staging/main armhf python3-dev armhf 3.10.6-1 [25.4 kB]
Get:81 http://172.17.4.1/private bookworm-staging/main armhf python3-all-dev armhf 3.10.6-1 [1068 B]
Get:82 http://172.17.4.1/private bookworm-staging/main armhf python3-pkg-resources all 65.5.0-1 [278 kB]
Get:83 http://172.17.4.1/private bookworm-staging/main armhf python3-setuptools all 65.5.0-1 [519 kB]
Get:84 http://172.17.4.1/private bookworm-staging/main armhf rename all 1.31-1 [22.1 kB]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 40.6 MB in 4s (9159 kB/s)
(Reading database ... 14774 files and directories currently installed.)
Preparing to unpack .../bsdutils_1%3a2.38.1-4_armhf.deb ...
Unpacking bsdutils (1:2.38.1-4) over (1:2.38.1-1.1) ...
Setting up bsdutils (1:2.38.1-4) ...
(Reading database ... 14774 files and directories currently installed.)
Preparing to unpack .../libsmartcols1_2.38.1-4_armhf.deb ...
Unpacking libsmartcols1:armhf (2.38.1-4) over (2.38.1-1.1) ...
Setting up libsmartcols1:armhf (2.38.1-4) ...
(Reading database ... 14774 files and directories currently installed.)
Preparing to unpack .../util-linux-extra_2.38.1-4_armhf.deb ...
Unpacking util-linux-extra (2.38.1-4) over (2.38.1-1.1) ...
Setting up util-linux-extra (2.38.1-4) ...
(Reading database ... 14774 files and directories currently installed.)
Preparing to unpack .../util-linux_2.38.1-4_armhf.deb ...
Unpacking util-linux (2.38.1-4) over (2.38.1-1.1) ...
Setting up util-linux (2.38.1-4) ...
(Reading database ... 14773 files and directories currently installed.)
Preparing to unpack .../mount_2.38.1-4_armhf.deb ...
Unpacking mount (2.38.1-4) over (2.38.1-1.1) ...
Selecting previously unselected package libpython3.10-minimal:armhf.
Preparing to unpack .../libpython3.10-minimal_3.10.8-3_armhf.deb ...
Unpacking libpython3.10-minimal:armhf (3.10.8-3) ...
Selecting previously unselected package libexpat1:armhf.
Preparing to unpack .../libexpat1_2.5.0-1_armhf.deb ...
Unpacking libexpat1:armhf (2.5.0-1) ...
Selecting previously unselected package python3.10-minimal.
Preparing to unpack .../python3.10-minimal_3.10.8-3_armhf.deb ...
Unpacking python3.10-minimal (3.10.8-3) ...
Setting up libpython3.10-minimal:armhf (3.10.8-3) ...
Setting up libexpat1:armhf (2.5.0-1) ...
Setting up python3.10-minimal (3.10.8-3) ...
Selecting previously unselected package python3-minimal.
(Reading database ... 15077 files and directories currently installed.)
Preparing to unpack .../python3-minimal_3.10.6-1_armhf.deb ...
Unpacking python3-minimal (3.10.6-1) ...
Selecting previously unselected package media-types.
Preparing to unpack .../media-types_8.0.0_all.deb ...
Unpacking media-types (8.0.0) ...
Selecting previously unselected package libmpdec3:armhf.
Preparing to unpack .../libmpdec3_2.5.1-2+rpi1_armhf.deb ...
Unpacking libmpdec3:armhf (2.5.1-2+rpi1) ...
Preparing to unpack .../libuuid1_2.38.1-4_armhf.deb ...
Unpacking libuuid1:armhf (2.38.1-4) over (2.38.1-1.1) ...
Setting up libuuid1:armhf (2.38.1-4) ...
Selecting previously unselected package libpython3.10-stdlib:armhf.
(Reading database ... 15111 files and directories currently installed.)
Preparing to unpack .../libpython3.10-stdlib_3.10.8-3_armhf.deb ...
Unpacking libpython3.10-stdlib:armhf (3.10.8-3) ...
Selecting previously unselected package python3.10.
Preparing to unpack .../python3.10_3.10.8-3_armhf.deb ...
Unpacking python3.10 (3.10.8-3) ...
Selecting previously unselected package libpython3-stdlib:armhf.
Preparing to unpack .../libpython3-stdlib_3.10.6-1_armhf.deb ...
Unpacking libpython3-stdlib:armhf (3.10.6-1) ...
Setting up python3-minimal (3.10.6-1) ...
Selecting previously unselected package python3.
(Reading database ... 15478 files and directories currently installed.)
Preparing to unpack .../python3_3.10.6-1_armhf.deb ...
Unpacking python3 (3.10.6-1) ...
Preparing to unpack .../libblkid1_2.38.1-4_armhf.deb ...
Unpacking libblkid1:armhf (2.38.1-4) over (2.38.1-1.1) ...
Setting up libblkid1:armhf (2.38.1-4) ...
(Reading database ... 15498 files and directories currently installed.)
Preparing to unpack .../libmount1_2.38.1-4_armhf.deb ...
Unpacking libmount1:armhf (2.38.1-4) over (2.38.1-1.1) ...
Setting up libmount1:armhf (2.38.1-4) ...
Selecting previously unselected package libuchardet0:armhf.
(Reading database ... 15498 files and directories currently installed.)
Preparing to unpack .../00-libuchardet0_0.0.7-1_armhf.deb ...
Unpacking libuchardet0:armhf (0.0.7-1) ...
Selecting previously unselected package groff-base.
Preparing to unpack .../01-groff-base_1.22.4-9_armhf.deb ...
Unpacking groff-base (1.22.4-9) ...
Selecting previously unselected package bsdextrautils.
Preparing to unpack .../02-bsdextrautils_2.38.1-4_armhf.deb ...
Unpacking bsdextrautils (2.38.1-4) ...
Selecting previously unselected package libpipeline1:armhf.
Preparing to unpack .../03-libpipeline1_1.5.7-1_armhf.deb ...
Unpacking libpipeline1:armhf (1.5.7-1) ...
Selecting previously unselected package man-db.
Preparing to unpack .../04-man-db_2.11.1-1_armhf.deb ...
Unpacking man-db (2.11.1-1) ...
Selecting previously unselected package libncurses6:armhf.
Preparing to unpack .../05-libncurses6_6.3+20220423-2_armhf.deb ...
Unpacking libncurses6:armhf (6.3+20220423-2) ...
Selecting previously unselected package libprocps8:armhf.
Preparing to unpack .../06-libprocps8_2%3a3.3.17-7.1_armhf.deb ...
Unpacking libprocps8:armhf (2:3.3.17-7.1) ...
Selecting previously unselected package procps.
Preparing to unpack .../07-procps_2%3a3.3.17-7.1_armhf.deb ...
Unpacking procps (2:3.3.17-7.1) ...
Selecting previously unselected package libmagic-mgc.
Preparing to unpack .../08-libmagic-mgc_1%3a5.41-4_armhf.deb ...
Unpacking libmagic-mgc (1:5.41-4) ...
Selecting previously unselected package libmagic1:armhf.
Preparing to unpack .../09-libmagic1_1%3a5.41-4_armhf.deb ...
Unpacking libmagic1:armhf (1:5.41-4) ...
Selecting previously unselected package file.
Preparing to unpack .../10-file_1%3a5.41-4_armhf.deb ...
Unpacking file (1:5.41-4) ...
Selecting previously unselected package gettext-base.
Preparing to unpack .../11-gettext-base_0.21-10_armhf.deb ...
Unpacking gettext-base (0.21-10) ...
Selecting previously unselected package m4.
Preparing to unpack .../12-m4_1.4.19-1_armhf.deb ...
Unpacking m4 (1.4.19-1) ...
Selecting previously unselected package autoconf.
Preparing to unpack .../13-autoconf_2.71-2_all.deb ...
Unpacking autoconf (2.71-2) ...
Selecting previously unselected package autotools-dev.
Preparing to unpack .../14-autotools-dev_20220109.1_all.deb ...
Unpacking autotools-dev (20220109.1) ...
Selecting previously unselected package automake.
Preparing to unpack .../15-automake_1%3a1.16.5-1.3_all.deb ...
Unpacking automake (1:1.16.5-1.3) ...
Selecting previously unselected package autopoint.
Preparing to unpack .../16-autopoint_0.21-10_all.deb ...
Unpacking autopoint (0.21-10) ...
Selecting previously unselected package libicu72:armhf.
Preparing to unpack .../17-libicu72_72.1-3_armhf.deb ...
Unpacking libicu72:armhf (72.1-3) ...
Selecting previously unselected package libxml2:armhf.
Preparing to unpack .../18-libxml2_2.9.14+dfsg-1.1_armhf.deb ...
Unpacking libxml2:armhf (2.9.14+dfsg-1.1) ...
Selecting previously unselected package libarchive13:armhf.
Preparing to unpack .../19-libarchive13_3.6.0-1_armhf.deb ...
Unpacking libarchive13:armhf (3.6.0-1) ...
Selecting previously unselected package libbrotli1:armhf.
Preparing to unpack .../20-libbrotli1_1.0.9-2+b2_armhf.deb ...
Unpacking libbrotli1:armhf (1.0.9-2+b2) ...
Selecting previously unselected package libnghttp2-14:armhf.
Preparing to unpack .../21-libnghttp2-14_1.50.0-1_armhf.deb ...
Unpacking libnghttp2-14:armhf (1.50.0-1) ...
Selecting previously unselected package libpsl5:armhf.
Preparing to unpack .../22-libpsl5_0.21.0-1.2_armhf.deb ...
Unpacking libpsl5:armhf (0.21.0-1.2) ...
Selecting previously unselected package librtmp1:armhf.
Preparing to unpack .../23-librtmp1_2.4+20151223.gitfa8646d.1-2+b2_armhf.deb ...
Unpacking librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b2) ...
Selecting previously unselected package libssh2-1:armhf.
Preparing to unpack .../24-libssh2-1_1.10.0-3+b1_armhf.deb ...
Unpacking libssh2-1:armhf (1.10.0-3+b1) ...
Selecting previously unselected package libcurl4:armhf.
Preparing to unpack .../25-libcurl4_7.86.0-2_armhf.deb ...
Unpacking libcurl4:armhf (7.86.0-2) ...
Selecting previously unselected package libjsoncpp25:armhf.
Preparing to unpack .../26-libjsoncpp25_1.9.5-4_armhf.deb ...
Unpacking libjsoncpp25:armhf (1.9.5-4) ...
Selecting previously unselected package librhash0:armhf.
Preparing to unpack .../27-librhash0_1.4.3-3_armhf.deb ...
Unpacking librhash0:armhf (1.4.3-3) ...
Selecting previously unselected package libuv1:armhf.
Preparing to unpack .../28-libuv1_1.44.2-1+rpi1_armhf.deb ...
Unpacking libuv1:armhf (1.44.2-1+rpi1) ...
Selecting previously unselected package cmake-data.
Preparing to unpack .../29-cmake-data_3.25.1-1_all.deb ...
Unpacking cmake-data (3.25.1-1) ...
Selecting previously unselected package cmake.
Preparing to unpack .../30-cmake_3.25.1-1_armhf.deb ...
Unpacking cmake (3.25.1-1) ...
Selecting previously unselected package cython3.
Preparing to unpack .../31-cython3_0.29.32-2_armhf.deb ...
Unpacking cython3 (0.29.32-2) ...
Selecting previously unselected package d-shlibs.
Preparing to unpack .../32-d-shlibs_0.104_all.deb ...
Unpacking d-shlibs (0.104) ...
Selecting previously unselected package libdebhelper-perl.
Preparing to unpack .../33-libdebhelper-perl_13.11.1_all.deb ...
Unpacking libdebhelper-perl (13.11.1) ...
Selecting previously unselected package libtool.
Preparing to unpack .../34-libtool_2.4.7-5_all.deb ...
Unpacking libtool (2.4.7-5) ...
Selecting previously unselected package dh-autoreconf.
Preparing to unpack .../35-dh-autoreconf_20_all.deb ...
Unpacking dh-autoreconf (20) ...
Selecting previously unselected package libarchive-zip-perl.
Preparing to unpack .../36-libarchive-zip-perl_1.68-1_all.deb ...
Unpacking libarchive-zip-perl (1.68-1) ...
Selecting previously unselected package libsub-override-perl.
Preparing to unpack .../37-libsub-override-perl_0.09-4_all.deb ...
Unpacking libsub-override-perl (0.09-4) ...
Selecting previously unselected package libfile-stripnondeterminism-perl.
Preparing to unpack .../38-libfile-stripnondeterminism-perl_1.13.0-2_all.deb ...
Unpacking libfile-stripnondeterminism-perl (1.13.0-2) ...
Selecting previously unselected package dh-strip-nondeterminism.
Preparing to unpack .../39-dh-strip-nondeterminism_1.13.0-2_all.deb ...
Unpacking dh-strip-nondeterminism (1.13.0-2) ...
Selecting previously unselected package libelf1:armhf.
Preparing to unpack .../40-libelf1_0.187-2+rpi2_armhf.deb ...
Unpacking libelf1:armhf (0.187-2+rpi2) ...
Selecting previously unselected package dwz.
Preparing to unpack .../41-dwz_0.14+20220924-2_armhf.deb ...
Unpacking dwz (0.14+20220924-2) ...
Selecting previously unselected package gettext.
Preparing to unpack .../42-gettext_0.21-10_armhf.deb ...
Unpacking gettext (0.21-10) ...
Selecting previously unselected package intltool-debian.
Preparing to unpack .../43-intltool-debian_0.35.0+20060710.6_all.deb ...
Unpacking intltool-debian (0.35.0+20060710.6) ...
Selecting previously unselected package po-debconf.
Preparing to unpack .../44-po-debconf_1.0.21+nmu1_all.deb ...
Unpacking po-debconf (1.0.21+nmu1) ...
Selecting previously unselected package debhelper.
Preparing to unpack .../45-debhelper_13.11.1_all.deb ...
Unpacking debhelper (13.11.1) ...
Selecting previously unselected package python3-lib2to3.
Preparing to unpack .../46-python3-lib2to3_3.10.8-1_all.deb ...
Unpacking python3-lib2to3 (3.10.8-1) ...
Selecting previously unselected package python3-distutils.
Preparing to unpack .../47-python3-distutils_3.10.8-1_all.deb ...
Unpacking python3-distutils (3.10.8-1) ...
Selecting previously unselected package dh-python.
Preparing to unpack .../48-dh-python_5.20220819+rpi1_all.deb ...
Unpacking dh-python (5.20220819+rpi1) ...
Selecting previously unselected package libexpat1-dev:armhf.
Preparing to unpack .../49-libexpat1-dev_2.5.0-1_armhf.deb ...
Unpacking libexpat1-dev:armhf (2.5.0-1) ...
Selecting previously unselected package libjs-jquery.
Preparing to unpack .../50-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ...
Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ...
Selecting previously unselected package libjs-underscore.
Preparing to unpack .../51-libjs-underscore_1.13.4~dfsg+~1.11.4-2_all.deb ...
Unpacking libjs-underscore (1.13.4~dfsg+~1.11.4-2) ...
Selecting previously unselected package libjs-sphinxdoc.
Preparing to unpack .../52-libjs-sphinxdoc_4.5.0-4_all.deb ...
Unpacking libjs-sphinxdoc (4.5.0-4) ...
Selecting previously unselected package libpython3.10:armhf.
Preparing to unpack .../53-libpython3.10_3.10.8-3_armhf.deb ...
Unpacking libpython3.10:armhf (3.10.8-3) ...
Selecting previously unselected package zlib1g-dev:armhf.
Preparing to unpack .../54-zlib1g-dev_1%3a1.2.11.dfsg-4.1_armhf.deb ...
Unpacking zlib1g-dev:armhf (1:1.2.11.dfsg-4.1) ...
Selecting previously unselected package libpython3.10-dev:armhf.
Preparing to unpack .../55-libpython3.10-dev_3.10.8-3_armhf.deb ...
Unpacking libpython3.10-dev:armhf (3.10.8-3) ...
Selecting previously unselected package libpython3-dev:armhf.
Preparing to unpack .../56-libpython3-dev_3.10.6-1_armhf.deb ...
Unpacking libpython3-dev:armhf (3.10.6-1) ...
Selecting previously unselected package libpython3-all-dev:armhf.
Preparing to unpack .../57-libpython3-all-dev_3.10.6-1_armhf.deb ...
Unpacking libpython3-all-dev:armhf (3.10.6-1) ...
Selecting previously unselected package python3-all.
Preparing to unpack .../58-python3-all_3.10.6-1_armhf.deb ...
Unpacking python3-all (3.10.6-1) ...
Selecting previously unselected package python3.10-dev.
Preparing to unpack .../59-python3.10-dev_3.10.8-3_armhf.deb ...
Unpacking python3.10-dev (3.10.8-3) ...
Selecting previously unselected package python3-dev.
Preparing to unpack .../60-python3-dev_3.10.6-1_armhf.deb ...
Unpacking python3-dev (3.10.6-1) ...
Selecting previously unselected package python3-all-dev.
Preparing to unpack .../61-python3-all-dev_3.10.6-1_armhf.deb ...
Unpacking python3-all-dev (3.10.6-1) ...
Selecting previously unselected package python3-pkg-resources.
Preparing to unpack .../62-python3-pkg-resources_65.5.0-1_all.deb ...
Unpacking python3-pkg-resources (65.5.0-1) ...
Selecting previously unselected package python3-setuptools.
Preparing to unpack .../63-python3-setuptools_65.5.0-1_all.deb ...
Unpacking python3-setuptools (65.5.0-1) ...
Selecting previously unselected package rename.
Preparing to unpack .../64-rename_1.31-1_all.deb ...
Unpacking rename (1.31-1) ...
Selecting previously unselected package sbuild-build-depends-libedlib-dummy.
Preparing to unpack .../65-sbuild-build-depends-libedlib-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-libedlib-dummy (0.invalid.0) ...
Setting up media-types (8.0.0) ...
Setting up libpipeline1:armhf (1.5.7-1) ...
Setting up libpsl5:armhf (0.21.0-1.2) ...
Setting up libicu72:armhf (72.1-3) ...
Setting up bsdextrautils (2.38.1-4) ...
Setting up libmagic-mgc (1:5.41-4) ...
Setting up libarchive-zip-perl (1.68-1) ...
Setting up libdebhelper-perl (13.11.1) ...
Setting up libbrotli1:armhf (1.0.9-2+b2) ...
Setting up libnghttp2-14:armhf (1.50.0-1) ...
Setting up libmagic1:armhf (1:5.41-4) ...
Setting up gettext-base (0.21-10) ...
Setting up m4 (1.4.19-1) ...
Setting up rename (1.31-1) ...
update-alternatives: using /usr/bin/file-rename to provide /usr/bin/rename (rename) in auto mode
Setting up file (1:5.41-4) ...
Setting up autotools-dev (20220109.1) ...
Setting up libuv1:armhf (1.44.2-1+rpi1) ...
Setting up libexpat1-dev:armhf (2.5.0-1) ...
Setting up librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b2) ...
Setting up libncurses6:armhf (6.3+20220423-2) ...
Setting up autopoint (0.21-10) ...
Setting up libjsoncpp25:armhf (1.9.5-4) ...
Setting up d-shlibs (0.104) ...
Setting up autoconf (2.71-2) ...
Setting up zlib1g-dev:armhf (1:1.2.11.dfsg-4.1) ...
Setting up mount (2.38.1-4) ...
Setting up librhash0:armhf (1.4.3-3) ...
Setting up libuchardet0:armhf (0.0.7-1) ...
Setting up libmpdec3:armhf (2.5.1-2+rpi1) ...
Setting up libsub-override-perl (0.09-4) ...
Setting up libssh2-1:armhf (1.10.0-3+b1) ...
Setting up cmake-data (3.25.1-1) ...
Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ...
Setting up libelf1:armhf (0.187-2+rpi2) ...
Setting up libxml2:armhf (2.9.14+dfsg-1.1) ...
Setting up libprocps8:armhf (2:3.3.17-7.1) ...
Setting up libjs-underscore (1.13.4~dfsg+~1.11.4-2) ...
Setting up automake (1:1.16.5-1.3) ...
update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode
Setting up libfile-stripnondeterminism-perl (1.13.0-2) ...
Setting up gettext (0.21-10) ...
Setting up libtool (2.4.7-5) ...
Setting up libarchive13:armhf (3.6.0-1) ...
Setting up intltool-debian (0.35.0+20060710.6) ...
Setting up libpython3.10-stdlib:armhf (3.10.8-3) ...
Setting up dh-autoreconf (20) ...
Setting up libjs-sphinxdoc (4.5.0-4) ...
Setting up dh-strip-nondeterminism (1.13.0-2) ...
Setting up dwz (0.14+20220924-2) ...
Setting up groff-base (1.22.4-9) ...
Setting up procps (2:3.3.17-7.1) ...
Setting up libcurl4:armhf (7.86.0-2) ...
Setting up libpython3-stdlib:armhf (3.10.6-1) ...
Setting up libpython3.10:armhf (3.10.8-3) ...
Setting up python3.10 (3.10.8-3) ...
Setting up po-debconf (1.0.21+nmu1) ...
Setting up python3 (3.10.6-1) ...
Setting up man-db (2.11.1-1) ...
Not building database; man-db/auto-update is not 'true'.
Setting up cython3 (0.29.32-2) ...
Setting up libpython3.10-dev:armhf (3.10.8-3) ...
Setting up python3.10-dev (3.10.8-3) ...
Setting up cmake (3.25.1-1) ...
Setting up python3-lib2to3 (3.10.8-1) ...
Setting up python3-pkg-resources (65.5.0-1) ...
Setting up python3-distutils (3.10.8-1) ...
Setting up dh-python (5.20220819+rpi1) ...
Setting up libpython3-dev:armhf (3.10.6-1) ...
Setting up python3-setuptools (65.5.0-1) ...
Setting up python3-all (3.10.6-1) ...
Setting up debhelper (13.11.1) ...
Setting up libpython3-all-dev:armhf (3.10.6-1) ...
Setting up python3-dev (3.10.6-1) ...
Setting up python3-all-dev (3.10.6-1) ...
Setting up sbuild-build-depends-libedlib-dummy (0.invalid.0) ...
Processing triggers for libc-bin (2.35-2+rpi1) ...
W: No sandbox user '_apt' on the system, can not drop privileges
+------------------------------------------------------------------------------+
| Build environment |
+------------------------------------------------------------------------------+
Kernel: Linux 4.15.0-187-generic armhf (armv8l)
Toolchain package versions: binutils_2.39-6+rpi1 dpkg-dev_1.21.9+rpi1 g++-12_12.2.0-3+rpi1 gcc-12_12.2.0-3+rpi1 libc6-dev_2.35-2+rpi1 libstdc++-12-dev_12.2.0-3+rpi1 libstdc++6_12.2.0-3+rpi1 linux-libc-dev_5.19.6-1+rpi1
Package versions: adduser_3.129 apt_2.5.3 autoconf_2.71-2 automake_1:1.16.5-1.3 autopoint_0.21-10 autotools-dev_20220109.1 base-files_12.3+rpi1 base-passwd_3.6.1 bash_5.2~rc2-2 binutils_2.39-6+rpi1 binutils-arm-linux-gnueabihf_2.39-6+rpi1 binutils-common_2.39-6+rpi1 bsdextrautils_2.38.1-4 bsdutils_1:2.38.1-4 build-essential_12.9 bzip2_1.0.8-5+b2 cmake_3.25.1-1 cmake-data_3.25.1-1 coreutils_9.1-1 cpp_4:12.2.0-1+rpi1 cpp-12_12.2.0-3+rpi1 cython3_0.29.32-2 d-shlibs_0.104 dash_0.5.11+git20210903+057cd650a4ed-9 debconf_1.5.79 debhelper_13.11.1 debianutils_5.7-0.3 dh-autoreconf_20 dh-python_5.20220819+rpi1 dh-strip-nondeterminism_1.13.0-2 diffutils_1:3.8-1 dirmngr_2.2.39-1 dpkg_1.21.9+rpi1 dpkg-dev_1.21.9+rpi1 dwz_0.14+20220924-2 e2fsprogs_1.46.6~rc1-1 fakeroot_1.29-1 file_1:5.41-4 findutils_4.9.0-3 g++_4:12.2.0-1+rpi1 g++-12_12.2.0-3+rpi1 gcc_4:12.2.0-1+rpi1 gcc-12_12.2.0-3+rpi1 gcc-12-base_12.2.0-3+rpi1 gcc-7-base_7.5.0-6+rpi1+b2 gcc-8-base_8.4.0-7+rpi1 gcc-9-base_9.4.0-2+rpi1 gettext_0.21-10 gettext-base_0.21-10 gnupg_2.2.39-1 gnupg-l10n_2.2.39-1 gnupg-utils_2.2.39-1 gpg_2.2.39-1 gpg-agent_2.2.39-1 gpg-wks-client_2.2.39-1 gpg-wks-server_2.2.39-1 gpgconf_2.2.39-1 gpgsm_2.2.39-1 gpgv_2.2.39-1 grep_3.7-1 groff-base_1.22.4-9 gzip_1.12-1 hostname_3.23 init-system-helpers_1.64 intltool-debian_0.35.0+20060710.6 iputils-ping_3:20211215-1 krb5-locales_1.20-1 libacl1_2.3.1-1 libapt-pkg6.0_2.5.3 libarchive-zip-perl_1.68-1 libarchive13_3.6.0-1 libasan8_12.2.0-3+rpi1 libassuan0_2.5.5-4 libatomic1_12.2.0-3+rpi1 libattr1_1:2.5.1-1 libaudit-common_1:3.0.7-1.1 libaudit1_1:3.0.7-1.1 libbinutils_2.39-6+rpi1 libblkid1_2.38.1-4 libbrotli1_1.0.9-2+b2 libbz2-1.0_1.0.8-5+b2 libc-bin_2.35-2+rpi1 libc-dev-bin_2.35-2+rpi1 libc6_2.35-2+rpi1 libc6-dev_2.35-2+rpi1 libcap-ng0_0.8.3-1 libcap2_1:2.44-1 libcap2-bin_1:2.44-1 libcc1-0_12.2.0-3+rpi1 libcom-err2_1.46.6~rc1-1 libcrypt-dev_1:4.4.28-2 libcrypt1_1:4.4.28-2 libctf-nobfd0_2.39-6+rpi1 libctf0_2.39-6+rpi1 libcurl4_7.86.0-2 libdb5.3_5.3.28+dfsg1-0.10 libdebconfclient0_0.264 libdebhelper-perl_13.11.1 libdpkg-perl_1.21.9+rpi1 libelf1_0.187-2+rpi2 libexpat1_2.5.0-1 libexpat1-dev_2.5.0-1 libext2fs2_1.46.6~rc1-1 libfakeroot_1.29-1 libffi8_3.4.2-4 libfile-stripnondeterminism-perl_1.13.0-2 libgcc-12-dev_12.2.0-3+rpi1 libgcc-s1_12.2.0-3+rpi1 libgcrypt20_1.10.1-2+b2 libgdbm-compat4_1.23-3 libgdbm6_1.23-3 libgmp10_2:6.2.1+dfsg1-1.1 libgnutls30_3.7.8-2 libgomp1_12.2.0-3+rpi1 libgpg-error0_1.45-2 libgssapi-krb5-2_1.20-1 libhogweed6_3.8.1-2 libicu72_72.1-3 libidn2-0_2.3.3-1 libisl23_0.25-1 libjs-jquery_3.6.1+dfsg+~3.5.14-1 libjs-sphinxdoc_4.5.0-4 libjs-underscore_1.13.4~dfsg+~1.11.4-2 libjsoncpp25_1.9.5-4 libk5crypto3_1.20-1 libkeyutils1_1.6.3-1 libkrb5-3_1.20-1 libkrb5support0_1.20-1 libksba8_1.6.0-3 libldap-2.5-0_2.5.13+dfsg-2+rpi1 liblz4-1_1.9.4-1+rpi1 liblzma5_5.2.5-2.1 libmagic-mgc_1:5.41-4 libmagic1_1:5.41-4 libmount1_2.38.1-4 libmpc3_1.2.1-2 libmpdec3_2.5.1-2+rpi1 libmpfr6_4.1.0-3 libncurses6_6.3+20220423-2 libncursesw6_6.3+20220423-2 libnettle8_3.8.1-2 libnghttp2-14_1.50.0-1 libnpth0_1.6-3 libnsl-dev_1.3.0-2 libnsl2_1.3.0-2 libp11-kit0_0.24.1-1 libpam-cap_1:2.44-1 libpam-modules_1.5.2-5 libpam-modules-bin_1.5.2-5 libpam-runtime_1.5.2-5 libpam0g_1.5.2-5 libpcre2-8-0_10.40-1+b2 libpcre3_2:8.39-14 libperl5.34_5.34.0-5 libperl5.36_5.36.0-4 libpipeline1_1.5.7-1 libprocps8_2:3.3.17-7.1 libpsl5_0.21.0-1.2 libpython3-all-dev_3.10.6-1 libpython3-dev_3.10.6-1 libpython3-stdlib_3.10.6-1 libpython3.10_3.10.8-3 libpython3.10-dev_3.10.8-3 libpython3.10-minimal_3.10.8-3 libpython3.10-stdlib_3.10.8-3 libreadline8_8.2-1 librhash0_1.4.3-3 librtmp1_2.4+20151223.gitfa8646d.1-2+b2 libsasl2-2_2.1.28+dfsg-8 libsasl2-modules-db_2.1.28+dfsg-8 libseccomp2_2.5.4-1+rpi1 libselinux1_3.4-1 libsemanage-common_3.4-1 libsemanage2_3.4-1 libsepol1_3.1-1 libsepol2_3.4-2 libsmartcols1_2.38.1-4 libsqlite3-0_3.39.4-1 libss2_1.46.6~rc1-1 libssh2-1_1.10.0-3+b1 libssl1.1_1.1.1o-1 libssl3_3.0.5-4 libstdc++-12-dev_12.2.0-3+rpi1 libstdc++6_12.2.0-3+rpi1 libsub-override-perl_0.09-4 libsystemd0_251.5-1+rpi1 libtasn1-6_4.19.0-2 libtinfo6_6.3+20220423-2 libtirpc-common_1.3.3+ds-1 libtirpc-dev_1.3.3+ds-1 libtirpc3_1.3.3+ds-1 libtool_2.4.7-5 libubsan1_12.2.0-3+rpi1 libuchardet0_0.0.7-1 libudev1_251.5-1+rpi1 libunistring2_1.0-2 libuuid1_2.38.1-4 libuv1_1.44.2-1+rpi1 libxml2_2.9.14+dfsg-1.1 libxxhash0_0.8.1-1 libzstd1_1.5.2+dfsg-1 linux-libc-dev_5.19.6-1+rpi1 login_1:4.12.3+dfsg1-1 logsave_1.46.6~rc1-1 lsb-base_11.4+rpi1 m4_1.4.19-1 make_4.3-4.1 man-db_2.11.1-1 mawk_1.3.4.20200120-3.1 media-types_8.0.0 mount_2.38.1-4 nano_6.4-1 ncurses-base_6.3+20220423-2 ncurses-bin_6.3+20220423-2 netbase_6.3 passwd_1:4.12.3+dfsg1-1 patch_2.7.6-7 perl_5.36.0-4 perl-base_5.36.0-4 perl-modules-5.34_5.34.0-5 perl-modules-5.36_5.36.0-4 pinentry-curses_1.2.0-2 po-debconf_1.0.21+nmu1 procps_2:3.3.17-7.1 python3_3.10.6-1 python3-all_3.10.6-1 python3-all-dev_3.10.6-1 python3-dev_3.10.6-1 python3-distutils_3.10.8-1 python3-lib2to3_3.10.8-1 python3-minimal_3.10.6-1 python3-pkg-resources_65.5.0-1 python3-setuptools_65.5.0-1 python3.10_3.10.8-3 python3.10-dev_3.10.8-3 python3.10-minimal_3.10.8-3 raspbian-archive-keyring_20120528.2 readline-common_8.2-1 rename_1.31-1 rpcsvc-proto_1.4.2-4 sbuild-build-depends-core-dummy_0.invalid.0 sbuild-build-depends-libedlib-dummy_0.invalid.0 sed_4.8-1 sensible-utils_0.0.17 sgml-base_1.31 sysvinit-utils_3.05-6 tar_1.34+dfsg-1 tzdata_2022d-1 util-linux_2.38.1-4 util-linux-extra_2.38.1-4 xz-utils_5.2.5-2.1 zlib1g_1:1.2.11.dfsg-4.1 zlib1g-dev_1:1.2.11.dfsg-4.1
+------------------------------------------------------------------------------+
| Build |
+------------------------------------------------------------------------------+
Unpack source
-------------
gpgv: unknown type of key resource 'trustedkeys.kbx'
gpgv: keyblock resource '/tmp/dpkg-verify-sig.NP326zUc/trustedkeys.kbx': General error
gpgv: Signature made Wed Nov 30 18:53:34 2022 UTC
gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1
gpgv: issuer "tille@debian.org"
gpgv: Can't check signature: No public key
dpkg-source: warning: cannot verify signature ./libedlib_1.2.7-4.dsc
dpkg-source: info: extracting libedlib in /<<PKGBUILDDIR>>
dpkg-source: info: unpacking libedlib_1.2.7.orig.tar.gz
dpkg-source: info: unpacking libedlib_1.2.7-4.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying cython3.patch
dpkg-source: info: applying enable_shared_and_static.patch
dpkg-source: info: applying really_exclude_readme.rst.patch
dpkg-source: info: applying fix-package-version.patch
Check disk space
----------------
Sufficient free space for build
User Environment
----------------
APT_CONFIG=/var/lib/sbuild/apt.conf
DEB_BUILD_OPTIONS=parallel=4
HOME=/sbuild-nonexistent
LC_ALL=POSIX
LOGNAME=buildd
PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games
SCHROOT_ALIAS_NAME=bookworm-staging-armhf-sbuild
SCHROOT_CHROOT_NAME=bookworm-staging-armhf-sbuild
SCHROOT_COMMAND=env
SCHROOT_GID=112
SCHROOT_GROUP=buildd
SCHROOT_SESSION_ID=bookworm-staging-armhf-sbuild-037c9058-a5df-4944-af2f-44af7b40c4ea
SCHROOT_UID=107
SCHROOT_USER=buildd
SHELL=/bin/sh
USER=buildd
dpkg-buildpackage
-----------------
dpkg-buildpackage: info: source package libedlib
dpkg-buildpackage: info: source version 1.2.7-4
dpkg-buildpackage: info: source distribution unstable
dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
debian/rules clean
dh clean --with python3
dh_auto_clean
make -j4 clean
make[1]: Entering directory '/<<PKGBUILDDIR>>'
rm -rf meson-build
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
dh_clean
debian/rules binary-arch
dh binary-arch --with python3
dh_update_autotools_config -a
dh_autoreconf -a
debian/rules override_dh_auto_configure
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_configure --buildsystem=cmake -- -DCMAKE_BUILD_TYPE=Release -DEDLIB_BUILD_EXAMPLES=False -DBUILD_TESTING=False -DEDLIB_OMIT_README_RST=1 -DBUILD_SHARED_LIBS=ON
cd obj-arm-linux-gnueabihf && cmake -DCMAKE_INSTALL_PREFIX=/usr -DCMAKE_BUILD_TYPE=None -DCMAKE_INSTALL_SYSCONFDIR=/etc -DCMAKE_INSTALL_LOCALSTATEDIR=/var -DCMAKE_EXPORT_NO_PACKAGE_REGISTRY=ON -DCMAKE_FIND_USE_PACKAGE_REGISTRY=OFF -DCMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY=ON -DFETCHCONTENT_FULLY_DISCONNECTED=ON -DCMAKE_INSTALL_RUNSTATEDIR=/run -DCMAKE_SKIP_INSTALL_ALL_DEPENDENCY=ON "-GUnix Makefiles" -DCMAKE_VERBOSE_MAKEFILE=ON -DCMAKE_INSTALL_LIBDIR=lib/arm-linux-gnueabihf -DCMAKE_BUILD_TYPE=Release -DEDLIB_BUILD_EXAMPLES=False -DBUILD_TESTING=False -DEDLIB_OMIT_README_RST=1 -DBUILD_SHARED_LIBS=ON ..
-- The C compiler identification is GNU 12.2.0
-- The CXX compiler identification is GNU 12.2.0
-- Detecting C compiler ABI info
-- Detecting C compiler ABI info - done
-- Check for working C compiler: /usr/bin/cc - skipped
-- Detecting C compile features
-- Detecting C compile features - done
-- Detecting CXX compiler ABI info
-- Detecting CXX compiler ABI info - done
-- Check for working CXX compiler: /usr/bin/c++ - skipped
-- Detecting CXX compile features
-- Detecting CXX compile features - done
Setting warning flags
-- Performing Test WOLD_STYLE_CAST
-- Performing Test WOLD_STYLE_CAST - Success
-- Performing Test WSHADOW
-- Performing Test WSHADOW - Success
-- Configuring done
-- Generating done
CMake Warning:
Manually-specified variables were not used by the project:
CMAKE_EXPORT_NO_PACKAGE_REGISTRY
CMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY
CMAKE_FIND_USE_PACKAGE_REGISTRY
EDLIB_OMIT_README_RST
FETCHCONTENT_FULLY_DISCONNECTED
-- Build files have been written to: /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_auto_build
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_build --buildsystem=cmake
cd obj-arm-linux-gnueabihf && make -j4 "INSTALL=install --strip-program=true" VERBOSE=1
make[2]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -S/<<PKGBUILDDIR>> -B/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf//CMakeFiles/progress.marks
make -f CMakeFiles/Makefile2 all
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake --color=
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake --color=
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 16%] Building CXX object CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o
/usr/bin/c++ -DDLIB_BUILD -DEDLIB_SHARED -Dedlib_EXPORTS -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -fPIC -fvisibility=hidden -fvisibility-inlines-hidden -std=c++14 -MD -MT CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -MF CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o.d -o CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -c /<<PKGBUILDDIR>>/edlib/src/edlib.cpp
[ 33%] Building CXX object CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o
/usr/bin/c++ -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++14 -MD -MT CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -MF CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o.d -o CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -c /<<PKGBUILDDIR>>/edlib/src/edlib.cpp
[ 50%] Linking CXX static library lib/libedlib_static.a
/usr/bin/cmake -P CMakeFiles/edlib_static.dir/cmake_clean_target.cmake
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib_static.dir/link.txt --verbose=1
/usr/bin/ar qc lib/libedlib_static.a CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o
/usr/bin/ranlib lib/libedlib_static.a
[ 66%] Linking CXX shared library lib/libedlib.so
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib.dir/link.txt --verbose=1
/usr/bin/c++ -fPIC -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -shared -Wl,-soname,libedlib.so.1 -o lib/libedlib.so.1.2.7 CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 66%] Built target edlib_static
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color=
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 83%] Building CXX object CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o
/usr/bin/c++ -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++14 -MD -MT CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -MF CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o.d -o CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -c /<<PKGBUILDDIR>>/apps/aligner/aligner.cpp
/usr/bin/cmake -E cmake_symlink_library lib/libedlib.so.1.2.7 lib/libedlib.so.1 lib/libedlib.so
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 83%] Built target edlib
[100%] Linking CXX executable bin/edlib-aligner
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib-aligner.dir/link.txt --verbose=1
/usr/bin/c++ -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic "CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o" -o bin/edlib-aligner lib/libedlib_static.a
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[100%] Built target edlib-aligner
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles 0
make[2]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
# /usr/bin/make --directory=bindings/python
EDLIB_OMIT_README_RST=1 /usr/bin/make --directory=bindings/python edlib pyedlib.bycython.cpp
make[2]: Entering directory '/<<PKGBUILDDIR>>/bindings/python'
# create a clean (maybe updated) copy of edlib src
rm -rf edlib && cp -r ../../edlib .
cython3 --cplus edlib.pyx -o edlib.bycython.cpp
/usr/lib/python3/dist-packages/Cython/Compiler/Main.py:369: FutureWarning: Cython directive 'language_level' not set, using 2 for now (Py2). This will change in a later release! File: /<<PKGBUILDDIR>>/bindings/python/edlib.pyx
tree = Parsing.p_module(s, pxd, full_module_name)
make[2]: Leaving directory '/<<PKGBUILDDIR>>/bindings/python'
EDLIB_OMIT_README_RST=1 dh_auto_build --buildsystem=pybuild -- --dir bindings/python
I: pybuild base:240: /usr/bin/python3 setup.py build
running build
running build_ext
building 'edlib' extension
creating build
creating build/temp.linux-armhf-cpython-310
creating build/temp.linux-armhf-cpython-310/edlib
creating build/temp.linux-armhf-cpython-310/edlib/src
arm-linux-gnueabihf-gcc -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.10 -c edlib.bycython.cpp -o build/temp.linux-armhf-cpython-310/edlib.bycython.o -O3 -std=c++11
arm-linux-gnueabihf-gcc -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.10 -c edlib/src/edlib.cpp -o build/temp.linux-armhf-cpython-310/edlib/src/edlib.o -O3 -std=c++11
arm-linux-gnueabihf-g++ -shared -Wl,-O1 -Wl,-Bsymbolic-functions -g -fwrapv -O2 -Wl,-z,relro -Wl,-z,now -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 build/temp.linux-armhf-cpython-310/edlib.bycython.o build/temp.linux-armhf-cpython-310/edlib/src/edlib.o -L/usr/lib/arm-linux-gnueabihf -o /<<PKGBUILDDIR>>/.pybuild/cpython3_3.10_edlib/build/edlib.cpython-310-arm-linux-gnueabihf.so
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_auto_test
make[1]: Entering directory '/<<PKGBUILDDIR>>'
`find . -name edlib-aligner -type f -executable` -p apps/aligner/test_data/query.fasta apps/aligner/test_data/target.fasta
Using NW alignment mode.
Reading queries...
Read 1 queries, 110 residues total.
Reading target fasta file...
Read target, 109 residues.
Comparing queries to target...
Query #0 (110 residues): score = 17
T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48)
||||||| | |||||||||| |||||||||||||||||||||||||||
Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46)
T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92)
| |||||||||||| || |||||||||| ||||||||| |||||| |
Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94)
T: AESIKSKKKKKE-STTB (93 - 108)
||||||||||| |||
Q: -ESIKSKKKKKENSTT- (94 - 109)
Cpu time of searching: 0.000790
`find . -name runTests`
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
create-stamp debian/debhelper-build-stamp
dh_prep -a
debian/rules override_dh_auto_install
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_install --buildsystem=cmake
cd obj-arm-linux-gnueabihf && make -j4 install DESTDIR=/<<PKGBUILDDIR>>/debian/tmp AM_UPDATE_INFO_DIR=no "INSTALL=install --strip-program=true"
make[2]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -S/<<PKGBUILDDIR>> -B/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0
make -f CMakeFiles/Makefile2 preinstall
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[3]: Nothing to be done for 'preinstall'.
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
Install the project...
/usr/bin/cmake -P cmake_install.cmake
-- Install configuration: "Release"
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/pkgconfig/edlib-1.pc
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-config.cmake
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-config-version.cmake
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-targets.cmake
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-targets-release.cmake
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.7
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib_static.a
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/include/edlib.h
make[2]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
dh_auto_install --buildsystem=pybuild -- --dir bindings/python
I: pybuild base:240: /usr/bin/python3 setup.py install --root /<<PKGBUILDDIR>>/debian/python3-edlib
running install
/usr/lib/python3/dist-packages/setuptools/command/install.py:34: SetuptoolsDeprecationWarning: setup.py install is deprecated. Use build and pip and other standards-based tools.
warnings.warn(
running build
running build_ext
running install_lib
creating /<<PKGBUILDDIR>>/debian/python3-edlib
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.10
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.10/dist-packages
copying /<<PKGBUILDDIR>>/.pybuild/cpython3_3.10_edlib/build/edlib.cpython-310-arm-linux-gnueabihf.so -> /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.10/dist-packages
running install_egg_info
running egg_info
creating edlib.egg-info
writing edlib.egg-info/PKG-INFO
writing dependency_links to edlib.egg-info/dependency_links.txt
writing top-level names to edlib.egg-info/top_level.txt
writing manifest file 'edlib.egg-info/SOURCES.txt'
reading manifest file 'edlib.egg-info/SOURCES.txt'
reading manifest template 'MANIFEST.in'
writing manifest file 'edlib.egg-info/SOURCES.txt'
Copying edlib.egg-info to /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.10/dist-packages/edlib-1.3.8.post2.egg-info
Skipping SOURCES.txt
running install_scripts
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_install
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_install
file-rename 's/_static\.a/.a/' `find debian -name libedlib_static.a`
d-shlibmove --commit \
--multiarch \
--devunversioned \
--exclude-la \
--movedev debian/tmp/usr/include/* usr/include \
--movedev debian/tmp/usr/lib/*/cmake usr/lib/arm-linux-gnueabihf \
--movedev debian/tmp/usr/lib/*/pkgconfig usr/lib/arm-linux-gnueabihf \
debian/tmp/usr/lib/*/*.so
Library package automatic movement utility
set -e
install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
install -d -m 755 debian/libedlib1/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.a debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1 debian/libedlib1/usr/lib/arm-linux-gnueabihf
mv /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.7 debian/libedlib1/usr/lib/arm-linux-gnueabihf
PKGDEV=libedlib-dev
PKGSHL=libedlib1
install -d -m 755 debian/libedlib-dev/usr/include
mv debian/tmp/usr/include/edlib.h debian/libedlib-dev/usr/include
install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/cmake debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/pkgconfig debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
dh_installdocs -a
dh_installchangelogs -a
dh_installexamples -a
dh_installman -a
dh_python3 -a
dh_perl -a
dh_link -a
dh_strip_nondeterminism -a
dh_compress -a
dh_fixperms -a
dh_missing -a
dh_dwz -a
dh_strip -a
dh_makeshlibs -a
dh_shlibdeps -a
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/edlib-aligner/usr/bin/edlib-aligner was not linked against ld-linux-armhf.so.3 (it uses none of the library's symbols)
dh_installdeb -a
dh_gencontrol -a
dpkg-gencontrol: warning: Depends field of package libedlib-dev: substitution variable ${shlibs:Depends} used, but is not defined
dh_md5sums -a
dh_builddeb -a
dpkg-deb: building package 'libedlib1' in '../libedlib1_1.2.7-4_armhf.deb'.
dpkg-deb: building package 'python3-edlib-dbgsym' in '../python3-edlib-dbgsym_1.2.7-4_armhf.deb'.
dpkg-deb: building package 'libedlib-dev' in '../libedlib-dev_1.2.7-4_armhf.deb'.
dpkg-deb: building package 'edlib-aligner-dbgsym' in '../edlib-aligner-dbgsym_1.2.7-4_armhf.deb'.
dpkg-deb: building package 'libedlib1-dbgsym' in '../libedlib1-dbgsym_1.2.7-4_armhf.deb'.
dpkg-deb: building package 'edlib-aligner' in '../edlib-aligner_1.2.7-4_armhf.deb'.
dpkg-deb: building package 'python3-edlib' in '../python3-edlib_1.2.7-4_armhf.deb'.
dpkg-genbuildinfo --build=any -O../libedlib_1.2.7-4_armhf.buildinfo
dpkg-genchanges --build=any -mRaspbian mythic lxc autobuilder 1 <root@raspbian.org> -O../libedlib_1.2.7-4_armhf.changes
dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included)
dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
--------------------------------------------------------------------------------
Build finished at 2022-12-03T16:46:55Z
Finished
--------
I: Built successfully
+------------------------------------------------------------------------------+
| Post Build Chroot |
+------------------------------------------------------------------------------+
+------------------------------------------------------------------------------+
| Changes |
+------------------------------------------------------------------------------+
libedlib_1.2.7-4_armhf.changes:
-------------------------------
Format: 1.8
Date: Wed, 30 Nov 2022 19:51:17 +0100
Source: libedlib
Binary: edlib-aligner edlib-aligner-dbgsym libedlib-dev libedlib1 libedlib1-dbgsym python3-edlib python3-edlib-dbgsym
Architecture: armhf
Version: 1.2.7-4
Distribution: bookworm-staging
Urgency: medium
Maintainer: Raspbian mythic lxc autobuilder 1 <root@raspbian.org>
Changed-By: Andreas Tille <tille@debian.org>
Description:
edlib-aligner - edlib sequence alignment tool using edit distance
libedlib-dev - library for sequence alignment using edit distance (devel)
libedlib1 - library for sequence alignment using edit distance
python3-edlib - library for sequence alignment using edit distance (Python3 modul
Changes:
libedlib (1.2.7-4) unstable; urgency=medium
.
* Fix watch file
* Standards-Version: 4.6.1 (routine-update)
* No tab in license text (routine-update)
Checksums-Sha1:
bb10a58c8006c95eaf060f5df2706779e283038c 118552 edlib-aligner-dbgsym_1.2.7-4_armhf.deb
309044ed66c1c668badae30b3f0e1635a7b432b1 19716 edlib-aligner_1.2.7-4_armhf.deb
a2eef4e8ad58075175e80350d62544c55602e7f0 18992 libedlib-dev_1.2.7-4_armhf.deb
6033e0c37b015f9738877f0c20b92e73e9a63ab3 78224 libedlib1-dbgsym_1.2.7-4_armhf.deb
5c98142fc4f0928f6457f07f96a4778a34af94f0 14124 libedlib1_1.2.7-4_armhf.deb
f8ffa9b9f82273b04c51e50c828089fd4cbce917 8705 libedlib_1.2.7-4_armhf.buildinfo
3e606e672ffdca3c14d5107f159d6c701fca3925 281404 python3-edlib-dbgsym_1.2.7-4_armhf.deb
e2c6adceaac5955ff7bfb4592c7b64cec2b5a9b0 49836 python3-edlib_1.2.7-4_armhf.deb
Checksums-Sha256:
39ef622d7b7629d0ae6ab2c5133a68e38af3c2f00c2b7ea1dda7cc4c3b557a6e 118552 edlib-aligner-dbgsym_1.2.7-4_armhf.deb
27da8956962e953c1cabe52611b64c3ff595578583fe51f09b2f4e81869e34ff 19716 edlib-aligner_1.2.7-4_armhf.deb
5400fec9e16e268245268c81eb0926fa028097e7d69baafae288d33f538e6f31 18992 libedlib-dev_1.2.7-4_armhf.deb
8137652c021c19ff4f95d5b3ff3798843e972d383e782156898212b1070f81fc 78224 libedlib1-dbgsym_1.2.7-4_armhf.deb
66e6c0d071145f0d69c95fb2ce348379cb84f7e2b2227f2e3fbc7d716abbdc82 14124 libedlib1_1.2.7-4_armhf.deb
2ed41d07938e54c5aaf8c3a1e43b8e884a2578d4f44408806542f91a1adcc3e3 8705 libedlib_1.2.7-4_armhf.buildinfo
3799156482cfc7469740ab457c3dfebcb1d8e0ecd03d019ce1105e3a174f267f 281404 python3-edlib-dbgsym_1.2.7-4_armhf.deb
a4a06bdb16178c6f78328f1632cfbd99ec423858c16484a9be45178c2ec540ad 49836 python3-edlib_1.2.7-4_armhf.deb
Files:
6e787b5e2251f95835700af65c453f29 118552 debug optional edlib-aligner-dbgsym_1.2.7-4_armhf.deb
720b002fb5be3d4b9fa73114f5fbc36c 19716 science optional edlib-aligner_1.2.7-4_armhf.deb
f40c875f0a80c22c8827f3b73ba05c3f 18992 libdevel optional libedlib-dev_1.2.7-4_armhf.deb
b8c9e2d274deb1c946abf319dab098a0 78224 debug optional libedlib1-dbgsym_1.2.7-4_armhf.deb
9d1cb4ef3c2a7384ff7f5bb1ca9aaf48 14124 libs optional libedlib1_1.2.7-4_armhf.deb
794083e15135294d9df35b4a629749f2 8705 science optional libedlib_1.2.7-4_armhf.buildinfo
f3bce791486aa6cfb65a767664eb89f0 281404 debug optional python3-edlib-dbgsym_1.2.7-4_armhf.deb
ec265f4820ec431884c8cb4d2356cb96 49836 python optional python3-edlib_1.2.7-4_armhf.deb
+------------------------------------------------------------------------------+
| Package contents |
+------------------------------------------------------------------------------+
edlib-aligner-dbgsym_1.2.7-4_armhf.deb
--------------------------------------
new Debian package, version 2.0.
size 118552 bytes: control archive=544 bytes.
389 bytes, 12 lines control
106 bytes, 1 lines md5sums
Package: edlib-aligner-dbgsym
Source: libedlib
Version: 1.2.7-4
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 130
Depends: edlib-aligner (= 1.2.7-4)
Section: debug
Priority: optional
Description: debug symbols for edlib-aligner
Build-Ids: a33a75473b39a88141bf32ad42c1429b1d70dbfe
drwxr-xr-x root/root 0 2022-11-30 18:51 ./
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/debug/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/debug/.build-id/a3/
-rw-r--r-- root/root 122200 2022-11-30 18:51 ./usr/lib/debug/.build-id/a3/3a75473b39a88141bf32ad42c1429b1d70dbfe.debug
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/
lrwxrwxrwx root/root 0 2022-11-30 18:51 ./usr/share/doc/edlib-aligner-dbgsym -> edlib-aligner
edlib-aligner_1.2.7-4_armhf.deb
-------------------------------
new Debian package, version 2.0.
size 19716 bytes: control archive=1280 bytes.
1415 bytes, 31 lines control
545 bytes, 7 lines md5sums
Package: edlib-aligner
Source: libedlib
Version: 1.2.7-4
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 85
Depends: libc6 (>= 2.34), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2), libedlib1 (= 1.2.7-4)
Section: science
Priority: optional
Homepage: https://github.com/Martinsos/edlib
Description: edlib sequence alignment tool using edit distance
Edlib is a lightweight and super fast C/C++ library for sequence
alignment using edit distance. This package provides an aligner
using this library.
.
Features of libedlib
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
drwxr-xr-x root/root 0 2022-11-30 18:51 ./
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/bin/
-rwxr-xr-x root/root 67080 2022-11-30 18:51 ./usr/bin/edlib-aligner
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/edlib-aligner/
-rw-r--r-- root/root 1072 2022-11-30 18:51 ./usr/share/doc/edlib-aligner/changelog.Debian.gz
-rw-r--r-- root/root 1399 2022-11-30 18:51 ./usr/share/doc/edlib-aligner/copyright
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/edlib-aligner/examples/
drwxr-xr-x root/root 0 2021-08-20 22:00 ./usr/share/doc/edlib-aligner/examples/test_data/
-rw-r--r-- root/root 112 2021-08-20 22:00 ./usr/share/doc/edlib-aligner/examples/test_data/query.fasta
-rw-r--r-- root/root 111 2021-08-20 22:00 ./usr/share/doc/edlib-aligner/examples/test_data/target.fasta
-rw-r--r-- root/root 334 2022-11-30 18:51 ./usr/share/doc/edlib-aligner/run-unit-test
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/man/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/man/man1/
-rw-r--r-- root/root 815 2022-11-30 18:51 ./usr/share/man/man1/edlib-aligner.1.gz
libedlib-dev_1.2.7-4_armhf.deb
------------------------------
new Debian package, version 2.0.
size 18992 bytes: control archive=1392 bytes.
1528 bytes, 37 lines control
752 bytes, 9 lines md5sums
Package: libedlib-dev
Source: libedlib
Version: 1.2.7-4
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 64
Depends: libedlib1 (= 1.2.7-4)
Section: libdevel
Priority: optional
Multi-Arch: same
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance (devel)
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the static library and the header files.
drwxr-xr-x root/root 0 2022-11-30 18:51 ./
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/include/
-rw-r--r-- root/root 11041 2021-08-20 22:00 ./usr/include/edlib.h
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/cmake/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/cmake/edlib/
-rw-r--r-- root/root 1977 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-config-version.cmake
-rw-r--r-- root/root 1356 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-config.cmake
-rw-r--r-- root/root 1419 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-targets-release.cmake
-rw-r--r-- root/root 4628 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-targets.cmake
-rw-r--r-- root/root 23566 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/libedlib.a
lrwxrwxrwx root/root 0 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/libedlib.so -> libedlib.so.1
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/pkgconfig/
-rw-r--r-- root/root 251 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/pkgconfig/edlib-1.pc
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/libedlib-dev/
-rw-r--r-- root/root 1068 2022-11-30 18:51 ./usr/share/doc/libedlib-dev/changelog.Debian.gz
-rw-r--r-- root/root 1399 2022-11-30 18:51 ./usr/share/doc/libedlib-dev/copyright
libedlib1-dbgsym_1.2.7-4_armhf.deb
----------------------------------
new Debian package, version 2.0.
size 78224 bytes: control archive=548 bytes.
393 bytes, 13 lines control
106 bytes, 1 lines md5sums
Package: libedlib1-dbgsym
Source: libedlib
Version: 1.2.7-4
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 89
Depends: libedlib1 (= 1.2.7-4)
Section: debug
Priority: optional
Multi-Arch: same
Description: debug symbols for libedlib1
Build-Ids: c6d7ed3d010214ff3f6028b1a5b6d0fe5492aa3d
drwxr-xr-x root/root 0 2022-11-30 18:51 ./
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/debug/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/debug/.build-id/c6/
-rw-r--r-- root/root 80624 2022-11-30 18:51 ./usr/lib/debug/.build-id/c6/d7ed3d010214ff3f6028b1a5b6d0fe5492aa3d.debug
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/
lrwxrwxrwx root/root 0 2022-11-30 18:51 ./usr/share/doc/libedlib1-dbgsym -> libedlib1
libedlib1_1.2.7-4_armhf.deb
---------------------------
new Debian package, version 2.0.
size 14124 bytes: control archive=1496 bytes.
1526 bytes, 37 lines control
226 bytes, 3 lines md5sums
32 bytes, 1 lines shlibs
537 bytes, 10 lines symbols
68 bytes, 2 lines triggers
Package: libedlib1
Source: libedlib
Version: 1.2.7-4
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 82
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2)
Section: libs
Priority: optional
Multi-Arch: same
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the shared library.
drwxr-xr-x root/root 0 2022-11-30 18:51 ./
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/
lrwxrwxrwx root/root 0 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/libedlib.so.1 -> libedlib.so.1.2.7
-rw-r--r-- root/root 66920 2022-11-30 18:51 ./usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.7
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/libedlib1/
-rw-r--r-- root/root 1068 2022-11-30 18:51 ./usr/share/doc/libedlib1/changelog.Debian.gz
-rw-r--r-- root/root 1399 2022-11-30 18:51 ./usr/share/doc/libedlib1/copyright
python3-edlib-dbgsym_1.2.7-4_armhf.deb
--------------------------------------
new Debian package, version 2.0.
size 281404 bytes: control archive=556 bytes.
406 bytes, 13 lines control
106 bytes, 1 lines md5sums
Package: python3-edlib-dbgsym
Source: libedlib
Version: 1.2.7-4
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 308
Depends: python3-edlib (= 1.2.7-4)
Section: debug
Priority: optional
Multi-Arch: same
Description: debug symbols for python3-edlib
Build-Ids: f9d4a048efc65ce1085920ddbc29364814ca02bf
drwxr-xr-x root/root 0 2022-11-30 18:51 ./
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/debug/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/debug/.build-id/f9/
-rw-r--r-- root/root 304380 2022-11-30 18:51 ./usr/lib/debug/.build-id/f9/d4a048efc65ce1085920ddbc29364814ca02bf.debug
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/
lrwxrwxrwx root/root 0 2022-11-30 18:51 ./usr/share/doc/python3-edlib-dbgsym -> python3-edlib
python3-edlib_1.2.7-4_armhf.deb
-------------------------------
new Debian package, version 2.0.
size 49836 bytes: control archive=1380 bytes.
1589 bytes, 37 lines control
576 bytes, 6 lines md5sums
Package: python3-edlib
Source: libedlib
Version: 1.2.7-4
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 154
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2), python3 (<< 3.11), python3 (>= 3.10~)
Section: python
Priority: optional
Multi-Arch: same
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance (Python3 module)
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the Python3 module.
drwxr-xr-x root/root 0 2022-11-30 18:51 ./
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/python3/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/python3/dist-packages/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/lib/python3/dist-packages/edlib-1.3.8.post2.egg-info/
-rw-r--r-- root/root 337 2022-11-30 18:51 ./usr/lib/python3/dist-packages/edlib-1.3.8.post2.egg-info/PKG-INFO
-rw-r--r-- root/root 1 2022-11-30 18:51 ./usr/lib/python3/dist-packages/edlib-1.3.8.post2.egg-info/dependency_links.txt
-rw-r--r-- root/root 6 2022-11-30 18:51 ./usr/lib/python3/dist-packages/edlib-1.3.8.post2.egg-info/top_level.txt
-rw-r--r-- root/root 140180 2022-11-30 18:51 ./usr/lib/python3/dist-packages/edlib.cpython-310-arm-linux-gnueabihf.so
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/
drwxr-xr-x root/root 0 2022-11-30 18:51 ./usr/share/doc/python3-edlib/
-rw-r--r-- root/root 1068 2022-11-30 18:51 ./usr/share/doc/python3-edlib/changelog.Debian.gz
-rw-r--r-- root/root 1399 2022-11-30 18:51 ./usr/share/doc/python3-edlib/copyright
+------------------------------------------------------------------------------+
| Post Build |
+------------------------------------------------------------------------------+
+------------------------------------------------------------------------------+
| Cleanup |
+------------------------------------------------------------------------------+
Purging /<<BUILDDIR>>
Not cleaning session: cloned chroot in use
+------------------------------------------------------------------------------+
| Summary |
+------------------------------------------------------------------------------+
Build Architecture: armhf
Build-Space: 20484
Build-Time: 64
Distribution: bookworm-staging
Host Architecture: armhf
Install-Time: 636
Job: libedlib_1.2.7-4
Machine Architecture: armhf
Package: libedlib
Package-Time: 722
Source-Version: 1.2.7-4
Space: 20484
Status: successful
Version: 1.2.7-4
--------------------------------------------------------------------------------
Finished at 2022-12-03T16:46:55Z
Build needed 00:12:02, 20484k disk space