libedlib →
1.2.7-2 →
armhf → 2021-10-16 08:27:44
sbuild (Debian sbuild) 0.71.0 (24 Aug 2016) on bm-wb-02
+==============================================================================+
| libedlib 1.2.7-2 (armhf) Sat, 16 Oct 2021 08:13:01 +0000 |
+==============================================================================+
Package: libedlib
Version: 1.2.7-2
Source Version: 1.2.7-2
Distribution: bookworm-staging
Machine Architecture: armhf
Host Architecture: armhf
Build Architecture: armhf
I: NOTICE: Log filtering will replace 'var/lib/schroot/mount/bookworm-staging-armhf-sbuild-8d5608aa-b7ce-4831-a267-1550e3f4c400' with '<<CHROOT>>'
+------------------------------------------------------------------------------+
| Update chroot |
+------------------------------------------------------------------------------+
Get:1 http://172.17.0.1/private bookworm-staging InRelease [11.3 kB]
Get:2 http://172.17.0.1/private bookworm-staging/main Sources [12.4 MB]
Get:3 http://172.17.0.1/private bookworm-staging/main armhf Packages [13.4 MB]
Fetched 25.9 MB in 25s (1026 kB/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
+------------------------------------------------------------------------------+
| Fetch source files |
+------------------------------------------------------------------------------+
Check APT
---------
Checking available source versions...
Download source files with APT
------------------------------
Reading package lists...
NOTICE: 'libedlib' packaging is maintained in the 'Git' version control system at:
https://salsa.debian.org/med-team/libedlib.git
Please use:
git clone https://salsa.debian.org/med-team/libedlib.git
to retrieve the latest (possibly unreleased) updates to the package.
Need to get 4328 kB of source archives.
Get:1 http://172.17.0.1/private bookworm-staging/main libedlib 1.2.7-2 (dsc) [2221 B]
Get:2 http://172.17.0.1/private bookworm-staging/main libedlib 1.2.7-2 (tar) [4319 kB]
Get:3 http://172.17.0.1/private bookworm-staging/main libedlib 1.2.7-2 (diff) [7236 B]
Fetched 4328 kB in 1s (6373 kB/s)
Download complete and in download only mode
I: NOTICE: Log filtering will replace 'build/libedlib-KyVRrM/libedlib-1.2.7' with '<<PKGBUILDDIR>>'
I: NOTICE: Log filtering will replace 'build/libedlib-KyVRrM' with '<<BUILDDIR>>'
+------------------------------------------------------------------------------+
| Install build-essential |
+------------------------------------------------------------------------------+
Setup apt archive
-----------------
Merged Build-Depends: build-essential, fakeroot
Filtered Build-Depends: build-essential, fakeroot
dpkg-deb: building package 'sbuild-build-depends-core-dummy' in '/<<BUILDDIR>>/resolver-lQZTcN/apt_archive/sbuild-build-depends-core-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning: sbuild-build-depends-core-dummy
dpkg-scanpackages: info: Wrote 1 entries to output Packages file.
gpg: keybox '/<<BUILDDIR>>/resolver-lQZTcN/gpg/pubring.kbx' created
gpg: /<<BUILDDIR>>/resolver-lQZTcN/gpg/trustdb.gpg: trustdb created
gpg: key 35506D9A48F77B2E: public key "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" imported
gpg: Total number processed: 1
gpg: imported: 1
gpg: key 35506D9A48F77B2E: "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" not changed
gpg: key 35506D9A48F77B2E: secret key imported
gpg: Total number processed: 1
gpg: unchanged: 1
gpg: secret keys read: 1
gpg: secret keys imported: 1
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ Release [957 B]
Get:3 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ Sources [349 B]
Get:5 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ Packages [430 B]
Fetched 2106 B in 1s (2878 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...
Install core build dependencies (apt-based resolver)
----------------------------------------------------
Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following package was automatically installed and is no longer required:
netbase
Use 'apt autoremove' to remove it.
The following NEW packages will be installed:
sbuild-build-depends-core-dummy
0 upgraded, 1 newly installed, 0 to remove and 35 not upgraded.
Need to get 848 B of archives.
After this operation, 0 B of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ sbuild-build-depends-core-dummy 0.invalid.0 [848 B]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 848 B in 0s (22.7 kB/s)
Selecting previously unselected package sbuild-build-depends-core-dummy.
(Reading database ... 12484 files and directories currently installed.)
Preparing to unpack .../sbuild-build-depends-core-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-core-dummy (0.invalid.0) ...
Setting up sbuild-build-depends-core-dummy (0.invalid.0) ...
W: No sandbox user '_apt' on the system, can not drop privileges
+------------------------------------------------------------------------------+
| Check architectures |
+------------------------------------------------------------------------------+
Arch check ok (armhf included in any)
+------------------------------------------------------------------------------+
| Install package build dependencies |
+------------------------------------------------------------------------------+
Setup apt archive
-----------------
Merged Build-Depends: debhelper-compat (= 13), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools
Filtered Build-Depends: debhelper-compat (= 13), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools
dpkg-deb: building package 'sbuild-build-depends-libedlib-dummy' in '/<<BUILDDIR>>/resolver-lQZTcN/apt_archive/sbuild-build-depends-libedlib-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning: sbuild-build-depends-core-dummy sbuild-build-depends-libedlib-dummy
dpkg-scanpackages: info: Wrote 2 entries to output Packages file.
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ Release [963 B]
Get:3 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ Sources [537 B]
Get:5 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ Packages [617 B]
Fetched 2487 B in 1s (3362 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...
Install libedlib build dependencies (apt-based resolver)
--------------------------------------------------------
Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following package was automatically installed and is no longer required:
netbase
Use 'apt autoremove' to remove it.
The following additional packages will be installed:
autoconf automake autopoint autotools-dev bsdextrautils cmake cmake-data
cython3 d-shlibs debhelper dh-autoreconf dh-elpa-helper dh-python
dh-strip-nondeterminism dwz emacsen-common file gettext gettext-base
groff-base intltool-debian libarchive-zip-perl libarchive13 libbrotli1
libcurl4 libdebhelper-perl libelf1 libexpat1 libexpat1-dev libffi8
libfile-stripnondeterminism-perl libicu67 libjs-jquery libjs-sphinxdoc
libjs-underscore libjsoncpp24 libmagic-mgc libmagic1 libmpdec3 libncurses6
libnghttp2-14 libpipeline1 libprocps8 libpsl5 libpython3-all-dev
libpython3-dev libpython3-stdlib libpython3.9 libpython3.9-dev
libpython3.9-minimal libpython3.9-stdlib librhash0 librtmp1 libsigsegv2
libssh2-1 libsub-override-perl libtool libuchardet0 libuv1 libxml2 m4 man-db
media-types po-debconf procps python3 python3-all python3-all-dev
python3-dev python3-distutils python3-lib2to3 python3-minimal
python3-pkg-resources python3-setuptools python3.9 python3.9-dev
python3.9-minimal rename sensible-utils zlib1g-dev
Suggested packages:
autoconf-archive gnu-standards autoconf-doc cmake-doc ninja-build cython-doc
dh-make gettext-doc libasprintf-dev libgettextpo-dev groff lrzip libtool-doc
gfortran | fortran95-compiler gcj-jdk m4-doc apparmor less www-browser
libmail-box-perl python3-doc python3-tk python3-venv python-setuptools-doc
python3.9-venv python3.9-doc binfmt-support
Recommended packages:
curl | wget | lynx ca-certificates libarchive-cpio-perl javascript-common
libgpm2 publicsuffix libltdl-dev libmail-sendmail-perl psmisc
libio-stringy-perl libpod-parser-perl
The following NEW packages will be installed:
autoconf automake autopoint autotools-dev bsdextrautils cmake cmake-data
cython3 d-shlibs debhelper dh-autoreconf dh-elpa-helper dh-python
dh-strip-nondeterminism dwz emacsen-common file gettext gettext-base
groff-base intltool-debian libarchive-zip-perl libarchive13 libbrotli1
libcurl4 libdebhelper-perl libelf1 libexpat1 libexpat1-dev libffi8
libfile-stripnondeterminism-perl libicu67 libjs-jquery libjs-sphinxdoc
libjs-underscore libjsoncpp24 libmagic-mgc libmagic1 libmpdec3 libncurses6
libnghttp2-14 libpipeline1 libprocps8 libpsl5 libpython3-all-dev
libpython3-dev libpython3-stdlib libpython3.9 libpython3.9-dev
libpython3.9-minimal libpython3.9-stdlib librhash0 librtmp1 libsigsegv2
libssh2-1 libsub-override-perl libtool libuchardet0 libuv1 libxml2 m4 man-db
media-types po-debconf procps python3 python3-all python3-all-dev
python3-dev python3-distutils python3-lib2to3 python3-minimal
python3-pkg-resources python3-setuptools python3.9 python3.9-dev
python3.9-minimal rename sbuild-build-depends-libedlib-dummy sensible-utils
zlib1g-dev
0 upgraded, 81 newly installed, 0 to remove and 35 not upgraded.
Need to get 37.9 MB of archives.
After this operation, 153 MB of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-lQZTcN/apt_archive ./ sbuild-build-depends-libedlib-dummy 0.invalid.0 [904 B]
Get:2 http://172.17.0.1/private bookworm-staging/main armhf bsdextrautils armhf 2.37.2-3 [135 kB]
Get:3 http://172.17.0.1/private bookworm-staging/main armhf libuchardet0 armhf 0.0.7-1 [65.0 kB]
Get:4 http://172.17.0.1/private bookworm-staging/main armhf groff-base armhf 1.22.4-7 [793 kB]
Get:5 http://172.17.0.1/private bookworm-staging/main armhf libpipeline1 armhf 1.5.3-1 [29.9 kB]
Get:6 http://172.17.0.1/private bookworm-staging/main armhf man-db armhf 2.9.4-2 [1307 kB]
Get:7 http://172.17.0.1/private bookworm-staging/main armhf libpython3.9-minimal armhf 3.9.7-4+rpi1 [794 kB]
Get:8 http://172.17.0.1/private bookworm-staging/main armhf libexpat1 armhf 2.4.1-2 [80.3 kB]
Get:9 http://172.17.0.1/private bookworm-staging/main armhf python3.9-minimal armhf 3.9.7-4+rpi1 [1632 kB]
Get:10 http://172.17.0.1/private bookworm-staging/main armhf python3-minimal armhf 3.9.2-3 [38.2 kB]
Get:11 http://172.17.0.1/private bookworm-staging/main armhf media-types all 4.0.0 [30.3 kB]
Get:12 http://172.17.0.1/private bookworm-staging/main armhf libffi8 armhf 3.4.2-3 [21.3 kB]
Get:13 http://172.17.0.1/private bookworm-staging/main armhf libmpdec3 armhf 2.5.1-2+rpi1 [73.5 kB]
Get:14 http://172.17.0.1/private bookworm-staging/main armhf libpython3.9-stdlib armhf 3.9.7-4+rpi1 [1618 kB]
Get:15 http://172.17.0.1/private bookworm-staging/main armhf python3.9 armhf 3.9.7-4+rpi1 [480 kB]
Get:16 http://172.17.0.1/private bookworm-staging/main armhf libpython3-stdlib armhf 3.9.2-3 [21.4 kB]
Get:17 http://172.17.0.1/private bookworm-staging/main armhf python3 armhf 3.9.2-3 [37.9 kB]
Get:18 http://172.17.0.1/private bookworm-staging/main armhf libncurses6 armhf 6.2+20201114-4 [79.7 kB]
Get:19 http://172.17.0.1/private bookworm-staging/main armhf libprocps8 armhf 2:3.3.17-5 [60.5 kB]
Get:20 http://172.17.0.1/private bookworm-staging/main armhf procps armhf 2:3.3.17-5 [475 kB]
Get:21 http://172.17.0.1/private bookworm-staging/main armhf sensible-utils all 0.0.17 [21.5 kB]
Get:22 http://172.17.0.1/private bookworm-staging/main armhf libmagic-mgc armhf 1:5.39-3 [273 kB]
Get:23 http://172.17.0.1/private bookworm-staging/main armhf libmagic1 armhf 1:5.39-3 [117 kB]
Get:24 http://172.17.0.1/private bookworm-staging/main armhf file armhf 1:5.39-3 [68.0 kB]
Get:25 http://172.17.0.1/private bookworm-staging/main armhf gettext-base armhf 0.21-4 [171 kB]
Get:26 http://172.17.0.1/private bookworm-staging/main armhf libsigsegv2 armhf 2.13-1 [34.3 kB]
Get:27 http://172.17.0.1/private bookworm-staging/main armhf m4 armhf 1.4.18-5 [186 kB]
Get:28 http://172.17.0.1/private bookworm-staging/main armhf autoconf all 2.71-2 [343 kB]
Get:29 http://172.17.0.1/private bookworm-staging/main armhf autotools-dev all 20180224.1+nmu1 [77.1 kB]
Get:30 http://172.17.0.1/private bookworm-staging/main armhf automake all 1:1.16.4-2 [819 kB]
Get:31 http://172.17.0.1/private bookworm-staging/main armhf autopoint all 0.21-4 [510 kB]
Get:32 http://172.17.0.1/private bookworm-staging/main armhf libicu67 armhf 67.1-7 [8291 kB]
Get:33 http://172.17.0.1/private bookworm-staging/main armhf libxml2 armhf 2.9.12+dfsg-5 [584 kB]
Get:34 http://172.17.0.1/private bookworm-staging/main armhf libarchive13 armhf 3.4.3-2 [294 kB]
Get:35 http://172.17.0.1/private bookworm-staging/main armhf libbrotli1 armhf 1.0.9-2+b1 [261 kB]
Get:36 http://172.17.0.1/private bookworm-staging/main armhf libnghttp2-14 armhf 1.43.0-1 [65.3 kB]
Get:37 http://172.17.0.1/private bookworm-staging/main armhf libpsl5 armhf 0.21.0-1.2 [56.2 kB]
Get:38 http://172.17.0.1/private bookworm-staging/main armhf librtmp1 armhf 2.4+20151223.gitfa8646d.1-2+b2 [54.2 kB]
Get:39 http://172.17.0.1/private bookworm-staging/main armhf libssh2-1 armhf 1.10.0-2 [161 kB]
Get:40 http://172.17.0.1/private bookworm-staging/main armhf libcurl4 armhf 7.74.0-1.3 [305 kB]
Get:41 http://172.17.0.1/private bookworm-staging/main armhf libjsoncpp24 armhf 1.9.4-5 [67.4 kB]
Get:42 http://172.17.0.1/private bookworm-staging/main armhf librhash0 armhf 1.4.2-1 [141 kB]
Get:43 http://172.17.0.1/private bookworm-staging/main armhf libuv1 armhf 1.42.0-1 [121 kB]
Get:44 http://172.17.0.1/private bookworm-staging/main armhf dh-elpa-helper all 2.0.9 [11.2 kB]
Get:45 http://172.17.0.1/private bookworm-staging/main armhf emacsen-common all 3.0.4 [19.3 kB]
Get:46 http://172.17.0.1/private bookworm-staging/main armhf cmake-data all 3.21.3-4 [1878 kB]
Get:47 http://172.17.0.1/private bookworm-staging/main armhf cmake armhf 3.21.3-4 [3468 kB]
Get:48 http://172.17.0.1/private bookworm-staging/main armhf cython3 armhf 0.29.21-3+b1 [1234 kB]
Get:49 http://172.17.0.1/private bookworm-staging/main armhf d-shlibs all 0.100 [18.1 kB]
Get:50 http://172.17.0.1/private bookworm-staging/main armhf libdebhelper-perl all 13.5.2 [192 kB]
Get:51 http://172.17.0.1/private bookworm-staging/main armhf libtool all 2.4.6-15 [513 kB]
Get:52 http://172.17.0.1/private bookworm-staging/main armhf dh-autoreconf all 20 [17.1 kB]
Get:53 http://172.17.0.1/private bookworm-staging/main armhf libarchive-zip-perl all 1.68-1 [104 kB]
Get:54 http://172.17.0.1/private bookworm-staging/main armhf libsub-override-perl all 0.09-2 [10.2 kB]
Get:55 http://172.17.0.1/private bookworm-staging/main armhf libfile-stripnondeterminism-perl all 1.12.0-1 [26.3 kB]
Get:56 http://172.17.0.1/private bookworm-staging/main armhf dh-strip-nondeterminism all 1.12.0-1 [15.4 kB]
Get:57 http://172.17.0.1/private bookworm-staging/main armhf libelf1 armhf 0.185-2 [168 kB]
Get:58 http://172.17.0.1/private bookworm-staging/main armhf dwz armhf 0.14-1 [83.0 kB]
Get:59 http://172.17.0.1/private bookworm-staging/main armhf gettext armhf 0.21-4 [1215 kB]
Get:60 http://172.17.0.1/private bookworm-staging/main armhf intltool-debian all 0.35.0+20060710.5 [26.8 kB]
Get:61 http://172.17.0.1/private bookworm-staging/main armhf po-debconf all 1.0.21+nmu1 [248 kB]
Get:62 http://172.17.0.1/private bookworm-staging/main armhf debhelper all 13.5.2 [1056 kB]
Get:63 http://172.17.0.1/private bookworm-staging/main armhf python3-lib2to3 all 3.9.7-1 [79.4 kB]
Get:64 http://172.17.0.1/private bookworm-staging/main armhf python3-distutils all 3.9.7-1 [146 kB]
Get:65 http://172.17.0.1/private bookworm-staging/main armhf dh-python all 4.20201102+nmu1 [99.4 kB]
Get:66 http://172.17.0.1/private bookworm-staging/main armhf libexpat1-dev armhf 2.4.1-2 [135 kB]
Get:67 http://172.17.0.1/private bookworm-staging/main armhf libjs-jquery all 3.5.1+dfsg+~3.5.5-7 [315 kB]
Get:68 http://172.17.0.1/private bookworm-staging/main armhf libjs-underscore all 1.9.1~dfsg-4 [100 kB]
Get:69 http://172.17.0.1/private bookworm-staging/main armhf libjs-sphinxdoc all 4.2.0-4 [137 kB]
Get:70 http://172.17.0.1/private bookworm-staging/main armhf libpython3.9 armhf 3.9.7-4+rpi1 [1416 kB]
Get:71 http://172.17.0.1/private bookworm-staging/main armhf zlib1g-dev armhf 1:1.2.11.dfsg-2 [184 kB]
Get:72 http://172.17.0.1/private bookworm-staging/main armhf libpython3.9-dev armhf 3.9.7-4+rpi1 [3060 kB]
Get:73 http://172.17.0.1/private bookworm-staging/main armhf libpython3-dev armhf 3.9.2-3 [21.7 kB]
Get:74 http://172.17.0.1/private bookworm-staging/main armhf libpython3-all-dev armhf 3.9.2-3 [1068 B]
Get:75 http://172.17.0.1/private bookworm-staging/main armhf python3-all armhf 3.9.2-3 [1056 B]
Get:76 http://172.17.0.1/private bookworm-staging/main armhf python3.9-dev armhf 3.9.7-4+rpi1 [501 kB]
Get:77 http://172.17.0.1/private bookworm-staging/main armhf python3-dev armhf 3.9.2-3 [24.8 kB]
Get:78 http://172.17.0.1/private bookworm-staging/main armhf python3-all-dev armhf 3.9.2-3 [1064 B]
Get:79 http://172.17.0.1/private bookworm-staging/main armhf python3-pkg-resources all 58.2.0-1 [192 kB]
Get:80 http://172.17.0.1/private bookworm-staging/main armhf python3-setuptools all 58.2.0-1 [396 kB]
Get:81 http://172.17.0.1/private bookworm-staging/main armhf rename all 1.13-1 [18.0 kB]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 37.9 MB in 3s (12.2 MB/s)
Selecting previously unselected package bsdextrautils.
(Reading database ... 12484 files and directories currently installed.)
Preparing to unpack .../0-bsdextrautils_2.37.2-3_armhf.deb ...
Unpacking bsdextrautils (2.37.2-3) ...
Selecting previously unselected package libuchardet0:armhf.
Preparing to unpack .../1-libuchardet0_0.0.7-1_armhf.deb ...
Unpacking libuchardet0:armhf (0.0.7-1) ...
Selecting previously unselected package groff-base.
Preparing to unpack .../2-groff-base_1.22.4-7_armhf.deb ...
Unpacking groff-base (1.22.4-7) ...
Selecting previously unselected package libpipeline1:armhf.
Preparing to unpack .../3-libpipeline1_1.5.3-1_armhf.deb ...
Unpacking libpipeline1:armhf (1.5.3-1) ...
Selecting previously unselected package man-db.
Preparing to unpack .../4-man-db_2.9.4-2_armhf.deb ...
Unpacking man-db (2.9.4-2) ...
Selecting previously unselected package libpython3.9-minimal:armhf.
Preparing to unpack .../5-libpython3.9-minimal_3.9.7-4+rpi1_armhf.deb ...
Unpacking libpython3.9-minimal:armhf (3.9.7-4+rpi1) ...
Selecting previously unselected package libexpat1:armhf.
Preparing to unpack .../6-libexpat1_2.4.1-2_armhf.deb ...
Unpacking libexpat1:armhf (2.4.1-2) ...
Selecting previously unselected package python3.9-minimal.
Preparing to unpack .../7-python3.9-minimal_3.9.7-4+rpi1_armhf.deb ...
Unpacking python3.9-minimal (3.9.7-4+rpi1) ...
Setting up libpython3.9-minimal:armhf (3.9.7-4+rpi1) ...
Setting up libexpat1:armhf (2.4.1-2) ...
Setting up python3.9-minimal (3.9.7-4+rpi1) ...
Selecting previously unselected package python3-minimal.
(Reading database ... 13351 files and directories currently installed.)
Preparing to unpack .../0-python3-minimal_3.9.2-3_armhf.deb ...
Unpacking python3-minimal (3.9.2-3) ...
Selecting previously unselected package media-types.
Preparing to unpack .../1-media-types_4.0.0_all.deb ...
Unpacking media-types (4.0.0) ...
Selecting previously unselected package libffi8:armhf.
Preparing to unpack .../2-libffi8_3.4.2-3_armhf.deb ...
Unpacking libffi8:armhf (3.4.2-3) ...
Selecting previously unselected package libmpdec3:armhf.
Preparing to unpack .../3-libmpdec3_2.5.1-2+rpi1_armhf.deb ...
Unpacking libmpdec3:armhf (2.5.1-2+rpi1) ...
Selecting previously unselected package libpython3.9-stdlib:armhf.
Preparing to unpack .../4-libpython3.9-stdlib_3.9.7-4+rpi1_armhf.deb ...
Unpacking libpython3.9-stdlib:armhf (3.9.7-4+rpi1) ...
Selecting previously unselected package python3.9.
Preparing to unpack .../5-python3.9_3.9.7-4+rpi1_armhf.deb ...
Unpacking python3.9 (3.9.7-4+rpi1) ...
Selecting previously unselected package libpython3-stdlib:armhf.
Preparing to unpack .../6-libpython3-stdlib_3.9.2-3_armhf.deb ...
Unpacking libpython3-stdlib:armhf (3.9.2-3) ...
Setting up python3-minimal (3.9.2-3) ...
Selecting previously unselected package python3.
(Reading database ... 13754 files and directories currently installed.)
Preparing to unpack .../00-python3_3.9.2-3_armhf.deb ...
Unpacking python3 (3.9.2-3) ...
Selecting previously unselected package libncurses6:armhf.
Preparing to unpack .../01-libncurses6_6.2+20201114-4_armhf.deb ...
Unpacking libncurses6:armhf (6.2+20201114-4) ...
Selecting previously unselected package libprocps8:armhf.
Preparing to unpack .../02-libprocps8_2%3a3.3.17-5_armhf.deb ...
Unpacking libprocps8:armhf (2:3.3.17-5) ...
Selecting previously unselected package procps.
Preparing to unpack .../03-procps_2%3a3.3.17-5_armhf.deb ...
Unpacking procps (2:3.3.17-5) ...
Selecting previously unselected package sensible-utils.
Preparing to unpack .../04-sensible-utils_0.0.17_all.deb ...
Unpacking sensible-utils (0.0.17) ...
Selecting previously unselected package libmagic-mgc.
Preparing to unpack .../05-libmagic-mgc_1%3a5.39-3_armhf.deb ...
Unpacking libmagic-mgc (1:5.39-3) ...
Selecting previously unselected package libmagic1:armhf.
Preparing to unpack .../06-libmagic1_1%3a5.39-3_armhf.deb ...
Unpacking libmagic1:armhf (1:5.39-3) ...
Selecting previously unselected package file.
Preparing to unpack .../07-file_1%3a5.39-3_armhf.deb ...
Unpacking file (1:5.39-3) ...
Selecting previously unselected package gettext-base.
Preparing to unpack .../08-gettext-base_0.21-4_armhf.deb ...
Unpacking gettext-base (0.21-4) ...
Selecting previously unselected package libsigsegv2:armhf.
Preparing to unpack .../09-libsigsegv2_2.13-1_armhf.deb ...
Unpacking libsigsegv2:armhf (2.13-1) ...
Selecting previously unselected package m4.
Preparing to unpack .../10-m4_1.4.18-5_armhf.deb ...
Unpacking m4 (1.4.18-5) ...
Selecting previously unselected package autoconf.
Preparing to unpack .../11-autoconf_2.71-2_all.deb ...
Unpacking autoconf (2.71-2) ...
Selecting previously unselected package autotools-dev.
Preparing to unpack .../12-autotools-dev_20180224.1+nmu1_all.deb ...
Unpacking autotools-dev (20180224.1+nmu1) ...
Selecting previously unselected package automake.
Preparing to unpack .../13-automake_1%3a1.16.4-2_all.deb ...
Unpacking automake (1:1.16.4-2) ...
Selecting previously unselected package autopoint.
Preparing to unpack .../14-autopoint_0.21-4_all.deb ...
Unpacking autopoint (0.21-4) ...
Selecting previously unselected package libicu67:armhf.
Preparing to unpack .../15-libicu67_67.1-7_armhf.deb ...
Unpacking libicu67:armhf (67.1-7) ...
Selecting previously unselected package libxml2:armhf.
Preparing to unpack .../16-libxml2_2.9.12+dfsg-5_armhf.deb ...
Unpacking libxml2:armhf (2.9.12+dfsg-5) ...
Selecting previously unselected package libarchive13:armhf.
Preparing to unpack .../17-libarchive13_3.4.3-2_armhf.deb ...
Unpacking libarchive13:armhf (3.4.3-2) ...
Selecting previously unselected package libbrotli1:armhf.
Preparing to unpack .../18-libbrotli1_1.0.9-2+b1_armhf.deb ...
Unpacking libbrotli1:armhf (1.0.9-2+b1) ...
Selecting previously unselected package libnghttp2-14:armhf.
Preparing to unpack .../19-libnghttp2-14_1.43.0-1_armhf.deb ...
Unpacking libnghttp2-14:armhf (1.43.0-1) ...
Selecting previously unselected package libpsl5:armhf.
Preparing to unpack .../20-libpsl5_0.21.0-1.2_armhf.deb ...
Unpacking libpsl5:armhf (0.21.0-1.2) ...
Selecting previously unselected package librtmp1:armhf.
Preparing to unpack .../21-librtmp1_2.4+20151223.gitfa8646d.1-2+b2_armhf.deb ...
Unpacking librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b2) ...
Selecting previously unselected package libssh2-1:armhf.
Preparing to unpack .../22-libssh2-1_1.10.0-2_armhf.deb ...
Unpacking libssh2-1:armhf (1.10.0-2) ...
Selecting previously unselected package libcurl4:armhf.
Preparing to unpack .../23-libcurl4_7.74.0-1.3_armhf.deb ...
Unpacking libcurl4:armhf (7.74.0-1.3) ...
Selecting previously unselected package libjsoncpp24:armhf.
Preparing to unpack .../24-libjsoncpp24_1.9.4-5_armhf.deb ...
Unpacking libjsoncpp24:armhf (1.9.4-5) ...
Selecting previously unselected package librhash0:armhf.
Preparing to unpack .../25-librhash0_1.4.2-1_armhf.deb ...
Unpacking librhash0:armhf (1.4.2-1) ...
Selecting previously unselected package libuv1:armhf.
Preparing to unpack .../26-libuv1_1.42.0-1_armhf.deb ...
Unpacking libuv1:armhf (1.42.0-1) ...
Selecting previously unselected package dh-elpa-helper.
Preparing to unpack .../27-dh-elpa-helper_2.0.9_all.deb ...
Unpacking dh-elpa-helper (2.0.9) ...
Selecting previously unselected package emacsen-common.
Preparing to unpack .../28-emacsen-common_3.0.4_all.deb ...
Unpacking emacsen-common (3.0.4) ...
Selecting previously unselected package cmake-data.
Preparing to unpack .../29-cmake-data_3.21.3-4_all.deb ...
Unpacking cmake-data (3.21.3-4) ...
Selecting previously unselected package cmake.
Preparing to unpack .../30-cmake_3.21.3-4_armhf.deb ...
Unpacking cmake (3.21.3-4) ...
Selecting previously unselected package cython3.
Preparing to unpack .../31-cython3_0.29.21-3+b1_armhf.deb ...
Unpacking cython3 (0.29.21-3+b1) ...
Selecting previously unselected package d-shlibs.
Preparing to unpack .../32-d-shlibs_0.100_all.deb ...
Unpacking d-shlibs (0.100) ...
Selecting previously unselected package libdebhelper-perl.
Preparing to unpack .../33-libdebhelper-perl_13.5.2_all.deb ...
Unpacking libdebhelper-perl (13.5.2) ...
Selecting previously unselected package libtool.
Preparing to unpack .../34-libtool_2.4.6-15_all.deb ...
Unpacking libtool (2.4.6-15) ...
Selecting previously unselected package dh-autoreconf.
Preparing to unpack .../35-dh-autoreconf_20_all.deb ...
Unpacking dh-autoreconf (20) ...
Selecting previously unselected package libarchive-zip-perl.
Preparing to unpack .../36-libarchive-zip-perl_1.68-1_all.deb ...
Unpacking libarchive-zip-perl (1.68-1) ...
Selecting previously unselected package libsub-override-perl.
Preparing to unpack .../37-libsub-override-perl_0.09-2_all.deb ...
Unpacking libsub-override-perl (0.09-2) ...
Selecting previously unselected package libfile-stripnondeterminism-perl.
Preparing to unpack .../38-libfile-stripnondeterminism-perl_1.12.0-1_all.deb ...
Unpacking libfile-stripnondeterminism-perl (1.12.0-1) ...
Selecting previously unselected package dh-strip-nondeterminism.
Preparing to unpack .../39-dh-strip-nondeterminism_1.12.0-1_all.deb ...
Unpacking dh-strip-nondeterminism (1.12.0-1) ...
Selecting previously unselected package libelf1:armhf.
Preparing to unpack .../40-libelf1_0.185-2_armhf.deb ...
Unpacking libelf1:armhf (0.185-2) ...
Selecting previously unselected package dwz.
Preparing to unpack .../41-dwz_0.14-1_armhf.deb ...
Unpacking dwz (0.14-1) ...
Selecting previously unselected package gettext.
Preparing to unpack .../42-gettext_0.21-4_armhf.deb ...
Unpacking gettext (0.21-4) ...
Selecting previously unselected package intltool-debian.
Preparing to unpack .../43-intltool-debian_0.35.0+20060710.5_all.deb ...
Unpacking intltool-debian (0.35.0+20060710.5) ...
Selecting previously unselected package po-debconf.
Preparing to unpack .../44-po-debconf_1.0.21+nmu1_all.deb ...
Unpacking po-debconf (1.0.21+nmu1) ...
Selecting previously unselected package debhelper.
Preparing to unpack .../45-debhelper_13.5.2_all.deb ...
Unpacking debhelper (13.5.2) ...
Selecting previously unselected package python3-lib2to3.
Preparing to unpack .../46-python3-lib2to3_3.9.7-1_all.deb ...
Unpacking python3-lib2to3 (3.9.7-1) ...
Selecting previously unselected package python3-distutils.
Preparing to unpack .../47-python3-distutils_3.9.7-1_all.deb ...
Unpacking python3-distutils (3.9.7-1) ...
Selecting previously unselected package dh-python.
Preparing to unpack .../48-dh-python_4.20201102+nmu1_all.deb ...
Unpacking dh-python (4.20201102+nmu1) ...
Selecting previously unselected package libexpat1-dev:armhf.
Preparing to unpack .../49-libexpat1-dev_2.4.1-2_armhf.deb ...
Unpacking libexpat1-dev:armhf (2.4.1-2) ...
Selecting previously unselected package libjs-jquery.
Preparing to unpack .../50-libjs-jquery_3.5.1+dfsg+~3.5.5-7_all.deb ...
Unpacking libjs-jquery (3.5.1+dfsg+~3.5.5-7) ...
Selecting previously unselected package libjs-underscore.
Preparing to unpack .../51-libjs-underscore_1.9.1~dfsg-4_all.deb ...
Unpacking libjs-underscore (1.9.1~dfsg-4) ...
Selecting previously unselected package libjs-sphinxdoc.
Preparing to unpack .../52-libjs-sphinxdoc_4.2.0-4_all.deb ...
Unpacking libjs-sphinxdoc (4.2.0-4) ...
Selecting previously unselected package libpython3.9:armhf.
Preparing to unpack .../53-libpython3.9_3.9.7-4+rpi1_armhf.deb ...
Unpacking libpython3.9:armhf (3.9.7-4+rpi1) ...
Selecting previously unselected package zlib1g-dev:armhf.
Preparing to unpack .../54-zlib1g-dev_1%3a1.2.11.dfsg-2_armhf.deb ...
Unpacking zlib1g-dev:armhf (1:1.2.11.dfsg-2) ...
Selecting previously unselected package libpython3.9-dev:armhf.
Preparing to unpack .../55-libpython3.9-dev_3.9.7-4+rpi1_armhf.deb ...
Unpacking libpython3.9-dev:armhf (3.9.7-4+rpi1) ...
Selecting previously unselected package libpython3-dev:armhf.
Preparing to unpack .../56-libpython3-dev_3.9.2-3_armhf.deb ...
Unpacking libpython3-dev:armhf (3.9.2-3) ...
Selecting previously unselected package libpython3-all-dev:armhf.
Preparing to unpack .../57-libpython3-all-dev_3.9.2-3_armhf.deb ...
Unpacking libpython3-all-dev:armhf (3.9.2-3) ...
Selecting previously unselected package python3-all.
Preparing to unpack .../58-python3-all_3.9.2-3_armhf.deb ...
Unpacking python3-all (3.9.2-3) ...
Selecting previously unselected package python3.9-dev.
Preparing to unpack .../59-python3.9-dev_3.9.7-4+rpi1_armhf.deb ...
Unpacking python3.9-dev (3.9.7-4+rpi1) ...
Selecting previously unselected package python3-dev.
Preparing to unpack .../60-python3-dev_3.9.2-3_armhf.deb ...
Unpacking python3-dev (3.9.2-3) ...
Selecting previously unselected package python3-all-dev.
Preparing to unpack .../61-python3-all-dev_3.9.2-3_armhf.deb ...
Unpacking python3-all-dev (3.9.2-3) ...
Selecting previously unselected package python3-pkg-resources.
Preparing to unpack .../62-python3-pkg-resources_58.2.0-1_all.deb ...
Unpacking python3-pkg-resources (58.2.0-1) ...
Selecting previously unselected package python3-setuptools.
Preparing to unpack .../63-python3-setuptools_58.2.0-1_all.deb ...
Unpacking python3-setuptools (58.2.0-1) ...
Selecting previously unselected package rename.
Preparing to unpack .../64-rename_1.13-1_all.deb ...
Unpacking rename (1.13-1) ...
Selecting previously unselected package sbuild-build-depends-libedlib-dummy.
Preparing to unpack .../65-sbuild-build-depends-libedlib-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-libedlib-dummy (0.invalid.0) ...
Setting up media-types (4.0.0) ...
Setting up libpipeline1:armhf (1.5.3-1) ...
Setting up libpsl5:armhf (0.21.0-1.2) ...
Setting up bsdextrautils (2.37.2-3) ...
update-alternatives: using /usr/bin/write.ul to provide /usr/bin/write (write) in auto mode
Setting up libicu67:armhf (67.1-7) ...
Setting up libmagic-mgc (1:5.39-3) ...
Setting up libarchive-zip-perl (1.68-1) ...
Setting up libdebhelper-perl (13.5.2) ...
Setting up libbrotli1:armhf (1.0.9-2+b1) ...
Setting up libnghttp2-14:armhf (1.43.0-1) ...
Setting up libmagic1:armhf (1:5.39-3) ...
Setting up gettext-base (0.21-4) ...
Setting up rename (1.13-1) ...
update-alternatives: using /usr/bin/file-rename to provide /usr/bin/rename (rename) in auto mode
Setting up file (1:5.39-3) ...
Setting up autotools-dev (20180224.1+nmu1) ...
Setting up libuv1:armhf (1.42.0-1) ...
Setting up libexpat1-dev:armhf (2.4.1-2) ...
Setting up emacsen-common (3.0.4) ...
Setting up librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b2) ...
Setting up dh-elpa-helper (2.0.9) ...
Setting up libncurses6:armhf (6.2+20201114-4) ...
Setting up libsigsegv2:armhf (2.13-1) ...
Setting up autopoint (0.21-4) ...
Setting up d-shlibs (0.100) ...
Setting up libjsoncpp24:armhf (1.9.4-5) ...
Setting up zlib1g-dev:armhf (1:1.2.11.dfsg-2) ...
Setting up libffi8:armhf (3.4.2-3) ...
Setting up sensible-utils (0.0.17) ...
Setting up librhash0:armhf (1.4.2-1) ...
Setting up libuchardet0:armhf (0.0.7-1) ...
Setting up libmpdec3:armhf (2.5.1-2+rpi1) ...
Setting up libsub-override-perl (0.09-2) ...
Setting up libssh2-1:armhf (1.10.0-2) ...
Setting up cmake-data (3.21.3-4) ...
Setting up libjs-jquery (3.5.1+dfsg+~3.5.5-7) ...
Setting up libelf1:armhf (0.185-2) ...
Setting up libxml2:armhf (2.9.12+dfsg-5) ...
Setting up libprocps8:armhf (2:3.3.17-5) ...
Setting up libpython3.9-stdlib:armhf (3.9.7-4+rpi1) ...
Setting up libpython3-stdlib:armhf (3.9.2-3) ...
Setting up libjs-underscore (1.9.1~dfsg-4) ...
Setting up libfile-stripnondeterminism-perl (1.12.0-1) ...
Setting up gettext (0.21-4) ...
Setting up libtool (2.4.6-15) ...
Setting up libarchive13:armhf (3.4.3-2) ...
Setting up m4 (1.4.18-5) ...
Setting up intltool-debian (0.35.0+20060710.5) ...
Setting up libpython3.9:armhf (3.9.7-4+rpi1) ...
Setting up libjs-sphinxdoc (4.2.0-4) ...
Setting up autoconf (2.71-2) ...
Setting up dh-strip-nondeterminism (1.12.0-1) ...
Setting up dwz (0.14-1) ...
Setting up groff-base (1.22.4-7) ...
Setting up procps (2:3.3.17-5) ...
Setting up libcurl4:armhf (7.74.0-1.3) ...
Setting up python3.9 (3.9.7-4+rpi1) ...
Setting up automake (1:1.16.4-2) ...
update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode
Setting up po-debconf (1.0.21+nmu1) ...
Setting up libpython3.9-dev:armhf (3.9.7-4+rpi1) ...
Setting up python3 (3.9.2-3) ...
Setting up man-db (2.9.4-2) ...
Not building database; man-db/auto-update is not 'true'.
Setting up dh-autoreconf (20) ...
Setting up cython3 (0.29.21-3+b1) ...
Setting up python3.9-dev (3.9.7-4+rpi1) ...
Setting up cmake (3.21.3-4) ...
Setting up python3-lib2to3 (3.9.7-1) ...
Setting up python3-pkg-resources (58.2.0-1) ...
Setting up python3-distutils (3.9.7-1) ...
Setting up dh-python (4.20201102+nmu1) ...
Setting up libpython3-dev:armhf (3.9.2-3) ...
Setting up python3-setuptools (58.2.0-1) ...
Setting up python3-all (3.9.2-3) ...
Setting up debhelper (13.5.2) ...
Setting up libpython3-all-dev:armhf (3.9.2-3) ...
Setting up python3-dev (3.9.2-3) ...
Setting up python3-all-dev (3.9.2-3) ...
Setting up sbuild-build-depends-libedlib-dummy (0.invalid.0) ...
Processing triggers for libc-bin (2.32-4+rpi1) ...
W: No sandbox user '_apt' on the system, can not drop privileges
+------------------------------------------------------------------------------+
| Build environment |
+------------------------------------------------------------------------------+
Kernel: Linux 4.9.0-0.bpo.6-armmp armhf (armv7l)
Toolchain package versions: binutils_2.37-5+rpi1 dpkg-dev_1.20.9+rpi1 g++-10_10.3.0-9+rpi1 gcc-10_10.3.0-9+rpi1 libc6-dev_2.32-4+rpi1 libstdc++-10-dev_10.3.0-9+rpi1 libstdc++6_11.2.0-4+rpi1 linux-libc-dev_5.10.46-4+rpi1
Package versions: adduser_3.118 apt_2.3.9 autoconf_2.71-2 automake_1:1.16.4-2 autopoint_0.21-4 autotools-dev_20180224.1+nmu1 base-files_12+rpi1 base-passwd_3.5.51 bash_5.1-3 binutils_2.37-5+rpi1 binutils-arm-linux-gnueabihf_2.37-5+rpi1 binutils-common_2.37-5+rpi1 bsdextrautils_2.37.2-3 bsdutils_1:2.37.2-1 build-essential_12.9 bzip2_1.0.8-4 cmake_3.21.3-4 cmake-data_3.21.3-4 coreutils_8.32-4 cpp_4:10.2.1-1+rpi1 cpp-10_10.3.0-9+rpi1 cython3_0.29.21-3+b1 d-shlibs_0.100 dash_0.5.11+git20210120+802ebd4-1 debconf_1.5.77 debhelper_13.5.2 debianutils_4.11.2 dh-autoreconf_20 dh-elpa-helper_2.0.9 dh-python_4.20201102+nmu1 dh-strip-nondeterminism_1.12.0-1 diffutils_1:3.7-5 dirmngr_2.2.27-2 dpkg_1.20.9+rpi1 dpkg-dev_1.20.9+rpi1 dwz_0.14-1 e2fsprogs_1.46.4-1 emacsen-common_3.0.4 fakeroot_1.25.3-1.1 file_1:5.39-3 findutils_4.8.0-1 g++_4:10.2.1-1+rpi1 g++-10_10.3.0-9+rpi1 gcc_4:10.2.1-1+rpi1 gcc-10_10.3.0-9+rpi1 gcc-10-base_10.3.0-9+rpi1 gcc-11-base_11.2.0-4+rpi1 gcc-7-base_7.5.0-6+rpi1+b2 gcc-8-base_8.4.0-7+rpi1 gcc-9-base_9.4.0-2+rpi1 gettext_0.21-4 gettext-base_0.21-4 gnupg_2.2.27-2 gnupg-l10n_2.2.27-2 gnupg-utils_2.2.27-2 gpg_2.2.27-2 gpg-agent_2.2.27-2 gpg-wks-client_2.2.27-2 gpg-wks-server_2.2.27-2 gpgconf_2.2.27-2 gpgsm_2.2.27-2 gpgv_2.2.27-2 grep_3.7-1 groff-base_1.22.4-7 gzip_1.10-4 hostname_3.23 init-system-helpers_1.60 intltool-debian_0.35.0+20060710.5 libacl1_2.3.1-1 libapt-pkg6.0_2.3.9 libarchive-zip-perl_1.68-1 libarchive13_3.4.3-2 libasan6_11.2.0-4+rpi1 libassuan0_2.5.5-1 libatomic1_11.2.0-4+rpi1 libattr1_1:2.5.1-1 libaudit-common_1:3.0.5-1 libaudit1_1:3.0.5-1 libbinutils_2.37-5+rpi1 libblkid1_2.37.2-1 libbrotli1_1.0.9-2+b1 libbz2-1.0_1.0.8-4 libc-bin_2.32-4+rpi1 libc-dev-bin_2.32-4+rpi1 libc6_2.32-4+rpi1 libc6-dev_2.32-4+rpi1 libcap-ng0_0.7.9-2.2+b1 libcc1-0_11.2.0-4+rpi1 libcom-err2_1.46.4-1 libcrypt-dev_1:4.4.25-2 libcrypt1_1:4.4.25-2 libctf-nobfd0_2.37-5+rpi1 libctf0_2.37-5+rpi1 libcurl4_7.74.0-1.3 libdb5.3_5.3.28+dfsg1-0.8 libdebconfclient0_0.260 libdebhelper-perl_13.5.2 libdpkg-perl_1.20.9+rpi1 libelf1_0.185-2 libexpat1_2.4.1-2 libexpat1-dev_2.4.1-2 libext2fs2_1.46.4-1 libfakeroot_1.25.3-1.1 libffi7_3.3-6 libffi8_3.4.2-3 libfile-stripnondeterminism-perl_1.12.0-1 libgcc-10-dev_10.3.0-9+rpi1 libgcc-s1_11.2.0-4+rpi1 libgcrypt20_1.9.4-3 libgdbm-compat4_1.21-1 libgdbm6_1.21-1 libgmp10_2:6.2.1+dfsg-2 libgnutls30_3.7.2-2 libgomp1_11.2.0-4+rpi1 libgpg-error0_1.42-3 libgssapi-krb5-2_1.18.3-7 libhogweed6_3.7.3-1 libicu67_67.1-7 libidn2-0_2.3.2-2 libisl23_0.23-1 libjs-jquery_3.5.1+dfsg+~3.5.5-7 libjs-sphinxdoc_4.2.0-4 libjs-underscore_1.9.1~dfsg-4 libjsoncpp24_1.9.4-5 libk5crypto3_1.18.3-7 libkeyutils1_1.6.1-2 libkrb5-3_1.18.3-7 libkrb5support0_1.18.3-7 libksba8_1.6.0-2 libldap-2.4-2_2.4.59+dfsg-1 liblocale-gettext-perl_1.07-4+b1 liblz4-1_1.9.3-2 liblzma5_5.2.5-2 libmagic-mgc_1:5.39-3 libmagic1_1:5.39-3 libmount1_2.37.2-1 libmpc3_1.2.0-1 libmpdec3_2.5.1-2+rpi1 libmpfr6_4.1.0-3 libncurses6_6.2+20201114-4 libncursesw6_6.2+20201114-4 libnettle8_3.7.3-1 libnghttp2-14_1.43.0-1 libnpth0_1.6-3 libnsl-dev_1.3.0-2 libnsl2_1.3.0-2 libp11-kit0_0.24.0-2 libpam-modules_1.4.0-10 libpam-modules-bin_1.4.0-10 libpam-runtime_1.4.0-10 libpam0g_1.4.0-10 libpcre2-8-0_10.36-2 libpcre3_2:8.39-13 libperl5.32_5.32.1-5 libpipeline1_1.5.3-1 libprocps8_2:3.3.17-5 libpsl5_0.21.0-1.2 libpython3-all-dev_3.9.2-3 libpython3-dev_3.9.2-3 libpython3-stdlib_3.9.2-3 libpython3.9_3.9.7-4+rpi1 libpython3.9-dev_3.9.7-4+rpi1 libpython3.9-minimal_3.9.7-4+rpi1 libpython3.9-stdlib_3.9.7-4+rpi1 libreadline8_8.1-2 librhash0_1.4.2-1 librtmp1_2.4+20151223.gitfa8646d.1-2+b2 libsasl2-2_2.1.27+dfsg-2.1 libsasl2-modules-db_2.1.27+dfsg-2.1 libseccomp2_2.5.1-1+rpi1 libselinux1_3.1-3 libsemanage-common_3.1-1 libsemanage1_3.1-1+b1 libsepol1_3.1-1 libsigsegv2_2.13-1 libsmartcols1_2.37.2-1 libsqlite3-0_3.36.0-2 libss2_1.46.4-1 libssh2-1_1.10.0-2 libssl1.1_1.1.1l-1 libstdc++-10-dev_10.3.0-9+rpi1 libstdc++6_11.2.0-4+rpi1 libsub-override-perl_0.09-2 libsystemd0_247.9-1+rpi1 libtasn1-6_4.17.0-2 libtext-charwidth-perl_0.04-10+b1 libtext-iconv-perl_1.7-7+b1 libtinfo6_6.2+20201114-4 libtirpc-common_1.3.2-2 libtirpc-dev_1.3.2-2 libtirpc3_1.3.2-2 libtool_2.4.6-15 libubsan1_11.2.0-4+rpi1 libuchardet0_0.0.7-1 libudev1_247.9-1+rpi1 libunistring2_0.9.10-6 libuuid1_2.37.2-1 libuv1_1.42.0-1 libxml2_2.9.12+dfsg-5 libxxhash0_0.8.0-2+rpi1 libzstd1_1.4.8+dfsg-2.1+rpi1 linux-libc-dev_5.10.46-4+rpi1 login_1:4.8.1-1 logsave_1.46.4-1 lsb-base_11.1.0+rpi1 m4_1.4.18-5 make_4.3-4.1 man-db_2.9.4-2 mawk_1.3.4.20200120-2 media-types_4.0.0 mount_2.37.2-1 ncurses-base_6.2+20201114-4 ncurses-bin_6.2+20201114-4 netbase_6.3 passwd_1:4.8.1-1 patch_2.7.6-7 perl_5.32.1-5 perl-base_5.32.1-5 perl-modules-5.32_5.32.1-5 pinentry-curses_1.1.0-4 po-debconf_1.0.21+nmu1 procps_2:3.3.17-5 python3_3.9.2-3 python3-all_3.9.2-3 python3-all-dev_3.9.2-3 python3-dev_3.9.2-3 python3-distutils_3.9.7-1 python3-lib2to3_3.9.7-1 python3-minimal_3.9.2-3 python3-pkg-resources_58.2.0-1 python3-setuptools_58.2.0-1 python3.9_3.9.7-4+rpi1 python3.9-dev_3.9.7-4+rpi1 python3.9-minimal_3.9.7-4+rpi1 raspbian-archive-keyring_20120528.2 readline-common_8.1-2 rename_1.13-1 rpcsvc-proto_1.4.2-4 sbuild-build-depends-core-dummy_0.invalid.0 sbuild-build-depends-libedlib-dummy_0.invalid.0 sed_4.8-1 sensible-utils_0.0.17 sysvinit-utils_3.00-1 tar_1.34+dfsg-1 tzdata_2021a-1 util-linux_2.37.2-1 xz-utils_5.2.5-2 zlib1g_1:1.2.11.dfsg-2 zlib1g-dev_1:1.2.11.dfsg-2
+------------------------------------------------------------------------------+
| Build |
+------------------------------------------------------------------------------+
Unpack source
-------------
gpgv: unknown type of key resource 'trustedkeys.kbx'
gpgv: keyblock resource '/tmp/dpkg-verify-sig.7dlxEgVb/trustedkeys.kbx': General error
gpgv: Signature made Thu Oct 14 07:31:54 2021 UTC
gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1
gpgv: issuer "tille@debian.org"
gpgv: Can't check signature: No public key
dpkg-source: warning: failed to verify signature on ./libedlib_1.2.7-2.dsc
dpkg-source: info: extracting libedlib in /<<PKGBUILDDIR>>
dpkg-source: info: unpacking libedlib_1.2.7.orig.tar.gz
dpkg-source: info: unpacking libedlib_1.2.7-2.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying cython3.patch
dpkg-source: info: applying enable_shared_and_static.patch
dpkg-source: info: applying really_exclude_readme.rst.patch
Check disc space
----------------
Sufficient free space for build
User Environment
----------------
APT_CONFIG=/var/lib/sbuild/apt.conf
DEB_BUILD_OPTIONS=parallel=4
HOME=/sbuild-nonexistent
LC_ALL=POSIX
LOGNAME=buildd
PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games
SCHROOT_ALIAS_NAME=bookworm-staging-armhf-sbuild
SCHROOT_CHROOT_NAME=bookworm-staging-armhf-sbuild
SCHROOT_COMMAND=env
SCHROOT_GID=109
SCHROOT_GROUP=buildd
SCHROOT_SESSION_ID=bookworm-staging-armhf-sbuild-8d5608aa-b7ce-4831-a267-1550e3f4c400
SCHROOT_UID=104
SCHROOT_USER=buildd
SHELL=/bin/sh
TERM=linux
USER=buildd
dpkg-buildpackage
-----------------
dpkg-buildpackage: info: source package libedlib
dpkg-buildpackage: info: source version 1.2.7-2
dpkg-buildpackage: info: source distribution unstable
dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
debian/rules clean
dh clean --with python3
dh_auto_clean
make -j4 clean
make[1]: Entering directory '/<<PKGBUILDDIR>>'
rm -rf meson-build
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
dh_clean
debian/rules binary-arch
dh binary-arch --with python3
dh_update_autotools_config -a
dh_autoreconf -a
debian/rules override_dh_auto_configure
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_configure --buildsystem=cmake -- -DCMAKE_BUILD_TYPE=Release -DEDLIB_BUILD_EXAMPLES=False -DBUILD_TESTING=False -DEDLIB_OMIT_README_RST=1
cd obj-arm-linux-gnueabihf && cmake -DCMAKE_INSTALL_PREFIX=/usr -DCMAKE_BUILD_TYPE=None -DCMAKE_INSTALL_SYSCONFDIR=/etc -DCMAKE_INSTALL_LOCALSTATEDIR=/var -DCMAKE_EXPORT_NO_PACKAGE_REGISTRY=ON -DCMAKE_FIND_USE_PACKAGE_REGISTRY=OFF -DCMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY=ON -DCMAKE_INSTALL_RUNSTATEDIR=/run -DCMAKE_SKIP_INSTALL_ALL_DEPENDENCY=ON "-GUnix Makefiles" -DCMAKE_VERBOSE_MAKEFILE=ON -DCMAKE_INSTALL_LIBDIR=lib/arm-linux-gnueabihf -DCMAKE_BUILD_TYPE=Release -DEDLIB_BUILD_EXAMPLES=False -DBUILD_TESTING=False -DEDLIB_OMIT_README_RST=1 ..
-- The C compiler identification is GNU 10.3.0
-- The CXX compiler identification is GNU 10.3.0
-- Detecting C compiler ABI info
-- Detecting C compiler ABI info - done
-- Check for working C compiler: /usr/bin/cc - skipped
-- Detecting C compile features
-- Detecting C compile features - done
-- Detecting CXX compiler ABI info
-- Detecting CXX compiler ABI info - done
-- Check for working CXX compiler: /usr/bin/c++ - skipped
-- Detecting CXX compile features
-- Detecting CXX compile features - done
Setting warning flags
-- Performing Test WOLD_STYLE_CAST
-- Performing Test WOLD_STYLE_CAST - Success
-- Performing Test WSHADOW
-- Performing Test WSHADOW - Success
-- Configuring done
-- Generating done
CMake Warning:
Manually-specified variables were not used by the project:
CMAKE_EXPORT_NO_PACKAGE_REGISTRY
CMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY
CMAKE_FIND_USE_PACKAGE_REGISTRY
EDLIB_OMIT_README_RST
-- Build files have been written to: /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_auto_build
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_build --buildsystem=cmake
cd obj-arm-linux-gnueabihf && make -j4 "INSTALL=install --strip-program=true" VERBOSE=1
make[2]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -S/<<PKGBUILDDIR>> -B/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf//CMakeFiles/progress.marks
make -f CMakeFiles/Makefile2 all
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake --color=
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake --color=
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 33%] Building CXX object CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o
[ 33%] Building CXX object CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o
/usr/bin/c++ -DDLIB_BUILD -Dedlib_EXPORTS -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -fPIC -fvisibility=hidden -fvisibility-inlines-hidden -std=c++14 -MD -MT CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -MF CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o.d -o CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -c /<<PKGBUILDDIR>>/edlib/src/edlib.cpp
/usr/bin/c++ -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++14 -MD -MT CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -MF CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o.d -o CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -c /<<PKGBUILDDIR>>/edlib/src/edlib.cpp
[ 50%] Linking CXX static library lib/libedlib_static.a
/usr/bin/cmake -P CMakeFiles/edlib_static.dir/cmake_clean_target.cmake
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib_static.dir/link.txt --verbose=1
/usr/bin/ar qc lib/libedlib_static.a CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o
/usr/bin/ranlib lib/libedlib_static.a
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 50%] Built target edlib_static
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color=
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 66%] Building CXX object CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o
/usr/bin/c++ -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++14 -MD -MT CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -MF CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o.d -o CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -c /<<PKGBUILDDIR>>/apps/aligner/aligner.cpp
[ 83%] Linking CXX shared library lib/libedlib.so
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib.dir/link.txt --verbose=1
/usr/bin/c++ -fPIC -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -shared -Wl,-soname,libedlib.so.1 -o lib/libedlib.so.1.2.6 CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o
/usr/bin/cmake -E cmake_symlink_library lib/libedlib.so.1.2.6 lib/libedlib.so.1 lib/libedlib.so
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 83%] Built target edlib
[100%] Linking CXX executable bin/edlib-aligner
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib-aligner.dir/link.txt --verbose=1
/usr/bin/c++ -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -o bin/edlib-aligner lib/libedlib_static.a
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[100%] Built target edlib-aligner
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles 0
make[2]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
# /usr/bin/make --directory=bindings/python
EDLIB_OMIT_README_RST=1 /usr/bin/make --directory=bindings/python edlib pyedlib.bycython.cpp
make[2]: Entering directory '/<<PKGBUILDDIR>>/bindings/python'
# create a clean (maybe updated) copy of edlib src
rm -rf edlib && cp -r ../../edlib .
cython3 --cplus edlib.pyx -o edlib.bycython.cpp
/usr/lib/python3/dist-packages/Cython/Compiler/Main.py:369: FutureWarning: Cython directive 'language_level' not set, using 2 for now (Py2). This will change in a later release! File: /<<PKGBUILDDIR>>/bindings/python/edlib.pyx
tree = Parsing.p_module(s, pxd, full_module_name)
make[2]: Leaving directory '/<<PKGBUILDDIR>>/bindings/python'
EDLIB_OMIT_README_RST=1 dh_auto_build --buildsystem=pybuild -- --dir bindings/python
I: pybuild base:232: /usr/bin/python3 setup.py build
/usr/lib/python3/dist-packages/setuptools/dist.py:717: UserWarning: Usage of dash-separated 'build-lib' will not be supported in future versions. Please use the underscore name 'build_lib' instead
warnings.warn(
/usr/lib/python3/dist-packages/setuptools/dist.py:717: UserWarning: Usage of dash-separated 'install-layout' will not be supported in future versions. Please use the underscore name 'install_layout' instead
warnings.warn(
/usr/lib/python3/dist-packages/setuptools/dist.py:717: UserWarning: Usage of dash-separated 'install-scripts' will not be supported in future versions. Please use the underscore name 'install_scripts' instead
warnings.warn(
/usr/lib/python3/dist-packages/setuptools/dist.py:717: UserWarning: Usage of dash-separated 'install-lib' will not be supported in future versions. Please use the underscore name 'install_lib' instead
warnings.warn(
running build
running build_ext
building 'edlib' extension
creating build
creating build/temp.linux-armhf-3.9
creating build/temp.linux-armhf-3.9/edlib
creating build/temp.linux-armhf-3.9/edlib/src
arm-linux-gnueabihf-gcc -pthread -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.9 -c edlib.bycython.cpp -o build/temp.linux-armhf-3.9/edlib.bycython.o -O3 -std=c++11
arm-linux-gnueabihf-gcc -pthread -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.9 -c edlib/src/edlib.cpp -o build/temp.linux-armhf-3.9/edlib/src/edlib.o -O3 -std=c++11
arm-linux-gnueabihf-g++ -pthread -shared -Wl,-O1 -Wl,-Bsymbolic-functions -g -fwrapv -O2 -Wl,-z,relro -Wl,-z,now -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 build/temp.linux-armhf-3.9/edlib.bycython.o build/temp.linux-armhf-3.9/edlib/src/edlib.o -o /<<PKGBUILDDIR>>/.pybuild/cpython3_3.9_edlib/build/edlib.cpython-39-arm-linux-gnueabihf.so
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_auto_test
make[1]: Entering directory '/<<PKGBUILDDIR>>'
`find . -name edlib-aligner -type f -executable` -p apps/aligner/test_data/query.fasta apps/aligner/test_data/target.fasta
Using NW alignment mode.
Reading queries...
Read 1 queries, 110 residues total.
Reading target fasta file...
Read target, 109 residues.
Comparing queries to target...
Query #0 (110 residues): score = 17
T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48)
||||||| | |||||||||| |||||||||||||||||||||||||||
Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46)
T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92)
| |||||||||||| || |||||||||| ||||||||| |||||| |
Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94)
T: AESIKSKKKKKE-STTB (93 - 108)
||||||||||| |||
Q: -ESIKSKKKKKENSTT- (94 - 109)
Cpu time of searching: 0.000512
`find . -name runTests`
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
create-stamp debian/debhelper-build-stamp
dh_prep -a
debian/rules override_dh_auto_install
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_install --buildsystem=cmake
cd obj-arm-linux-gnueabihf && make -j4 install DESTDIR=/<<PKGBUILDDIR>>/debian/tmp AM_UPDATE_INFO_DIR=no "INSTALL=install --strip-program=true"
make[2]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -S/<<PKGBUILDDIR>> -B/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0
make -f CMakeFiles/Makefile2 preinstall
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[3]: Nothing to be done for 'preinstall'.
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
Install the project...
/usr/bin/cmake -P cmake_install.cmake
-- Install configuration: "Release"
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/pkgconfig/edlib-1.pc
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-config.cmake
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-config-version.cmake
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-targets.cmake
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-targets-release.cmake
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.6
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib_static.a
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/include/edlib.h
make[2]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
dh_auto_install --buildsystem=pybuild -- --dir bindings/python
I: pybuild base:232: /usr/bin/python3 setup.py install --root /<<PKGBUILDDIR>>/debian/python3-edlib
/usr/lib/python3/dist-packages/setuptools/dist.py:717: UserWarning: Usage of dash-separated 'build-lib' will not be supported in future versions. Please use the underscore name 'build_lib' instead
warnings.warn(
/usr/lib/python3/dist-packages/setuptools/dist.py:717: UserWarning: Usage of dash-separated 'install-layout' will not be supported in future versions. Please use the underscore name 'install_layout' instead
warnings.warn(
/usr/lib/python3/dist-packages/setuptools/dist.py:717: UserWarning: Usage of dash-separated 'install-scripts' will not be supported in future versions. Please use the underscore name 'install_scripts' instead
warnings.warn(
/usr/lib/python3/dist-packages/setuptools/dist.py:717: UserWarning: Usage of dash-separated 'install-lib' will not be supported in future versions. Please use the underscore name 'install_lib' instead
warnings.warn(
running install
running build
running build_ext
running install_lib
creating /<<PKGBUILDDIR>>/debian/python3-edlib
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9/dist-packages
copying /<<PKGBUILDDIR>>/.pybuild/cpython3_3.9_edlib/build/edlib.cpython-39-arm-linux-gnueabihf.so -> /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9/dist-packages
running install_egg_info
running egg_info
creating edlib.egg-info
writing edlib.egg-info/PKG-INFO
writing dependency_links to edlib.egg-info/dependency_links.txt
writing top-level names to edlib.egg-info/top_level.txt
writing manifest file 'edlib.egg-info/SOURCES.txt'
reading manifest file 'edlib.egg-info/SOURCES.txt'
reading manifest template 'MANIFEST.in'
writing manifest file 'edlib.egg-info/SOURCES.txt'
Copying edlib.egg-info to /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9/dist-packages/edlib-1.3.8.post2.egg-info
Skipping SOURCES.txt
running install_scripts
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_install
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_install
file-rename 's/_static\.a/.a/' `find debian -name libedlib_static.a`
d-shlibmove --commit \
--multiarch \
--devunversioned \
--exclude-la \
--movedev debian/tmp/usr/include/* usr/include \
--movedev debian/tmp/usr/lib/*/cmake usr/lib/arm-linux-gnueabihf \
--movedev debian/tmp/usr/lib/*/pkgconfig usr/lib/arm-linux-gnueabihf \
debian/tmp/usr/lib/*/*.so
Library package automatic movement utility
set -e
install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
install -d -m 755 debian/libedlib1/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.a debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1 debian/libedlib1/usr/lib/arm-linux-gnueabihf
mv /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.6 debian/libedlib1/usr/lib/arm-linux-gnueabihf
PKGDEV=libedlib-dev
PKGSHL=libedlib1
install -d -m 755 debian/libedlib-dev/usr/include
mv debian/tmp/usr/include/edlib.h debian/libedlib-dev/usr/include
install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/cmake debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/pkgconfig debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
dh_installdocs -a
dh_installchangelogs -a
dh_installexamples -a
dh_installman -a
dh_python3 -a
dh_perl -a
dh_link -a
dh_strip_nondeterminism -a
dh_compress -a
dh_fixperms -a
dh_missing -a
dh_dwz -a
dh_strip -a
dh_makeshlibs -a
dh_shlibdeps -a
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/python3-edlib/usr/lib/python3/dist-packages/edlib.cpython-39-arm-linux-gnueabihf.so was not linked against libpthread.so.0 (it uses none of the library's symbols)
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/edlib-aligner/usr/bin/edlib-aligner was not linked against ld-linux-armhf.so.3 (it uses none of the library's symbols)
dh_installdeb -a
dh_gencontrol -a
dpkg-gencontrol: warning: Depends field of package libedlib-dev: substitution variable ${shlibs:Depends} used, but is not defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined
dh_md5sums -a
dh_builddeb -a
dpkg-deb: building package 'libedlib1' in '../libedlib1_1.2.7-2_armhf.deb'.
dpkg-deb: building package 'python3-edlib-dbgsym' in '../python3-edlib-dbgsym_1.2.7-2_armhf.deb'.
dpkg-deb: building package 'edlib-aligner-dbgsym' in '../edlib-aligner-dbgsym_1.2.7-2_armhf.deb'.
dpkg-deb: building package 'libedlib-dev' in '../libedlib-dev_1.2.7-2_armhf.deb'.
dpkg-deb: building package 'libedlib1-dbgsym' in '../libedlib1-dbgsym_1.2.7-2_armhf.deb'.
dpkg-deb: building package 'edlib-aligner' in '../edlib-aligner_1.2.7-2_armhf.deb'.
dpkg-deb: building package 'python3-edlib' in '../python3-edlib_1.2.7-2_armhf.deb'.
dpkg-genbuildinfo --build=any
dpkg-genchanges --build=any -mRaspbian wandboard test autobuilder <root@raspbian.org> >../libedlib_1.2.7-2_armhf.changes
dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included)
dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
--------------------------------------------------------------------------------
Build finished at 2021-10-16T08:27:36Z
Finished
--------
I: Built successfully
+------------------------------------------------------------------------------+
| Post Build Chroot |
+------------------------------------------------------------------------------+
+------------------------------------------------------------------------------+
| Changes |
+------------------------------------------------------------------------------+
libedlib_1.2.7-2_armhf.changes:
-------------------------------
Format: 1.8
Date: Thu, 14 Oct 2021 09:27:47 +0200
Source: libedlib
Binary: edlib-aligner edlib-aligner-dbgsym libedlib-dev libedlib1 libedlib1-dbgsym python3-edlib python3-edlib-dbgsym
Architecture: armhf
Version: 1.2.7-2
Distribution: bookworm-staging
Urgency: medium
Maintainer: Raspbian wandboard test autobuilder <root@raspbian.org>
Changed-By: Andreas Tille <tille@debian.org>
Description:
edlib-aligner - edlib sequence alignment tool using edit distance
libedlib-dev - library for sequence alignment using edit distance (devel)
libedlib1 - library for sequence alignment using edit distance
python3-edlib - library for sequence alignment using edit distance (Python3 modul
Changes:
libedlib (1.2.7-2) unstable; urgency=medium
.
* Source-only upload
Checksums-Sha1:
e3af5e06282b84e05ca3e21a06b1f6645160001b 117048 edlib-aligner-dbgsym_1.2.7-2_armhf.deb
397c26d0ef1450a028379476a313666b124a935b 19612 edlib-aligner_1.2.7-2_armhf.deb
f319753e0f342909d9debfef101ccd476c4a5803 18680 libedlib-dev_1.2.7-2_armhf.deb
0a12ded7f6b89ad46e2f559778b69e3472c14df5 74400 libedlib1-dbgsym_1.2.7-2_armhf.deb
017a3b896e16032f0277891d01167c179b96e137 13500 libedlib1_1.2.7-2_armhf.deb
29a07b97cb7dfae5840569a2fd7f565c3b067bf7 8724 libedlib_1.2.7-2_armhf.buildinfo
0252b21f438dcf8a6e113c9a2c6e20c4bc55e0c2 268436 python3-edlib-dbgsym_1.2.7-2_armhf.deb
d0a3e7bbf4119f370505c0121338c59603d12391 49836 python3-edlib_1.2.7-2_armhf.deb
Checksums-Sha256:
b8be1acbb58498e2850c611cb0a97cca4b543a79db47e2337f6761eb8afebf70 117048 edlib-aligner-dbgsym_1.2.7-2_armhf.deb
5444bc26d2b4712e47178edc008667371657bbbe8d1eebc6d7db1d805bf121a0 19612 edlib-aligner_1.2.7-2_armhf.deb
467d211b95eb4a8b6f282bc9c2c5cd3e3003b4730c786150f71c433215b1ae47 18680 libedlib-dev_1.2.7-2_armhf.deb
3a4cf17cd87fdebcd167f7cf26d80f6ef26e450cc94eec09f25e826f825480ff 74400 libedlib1-dbgsym_1.2.7-2_armhf.deb
66119d028fbd3622596ee19c72e9b99d34731daed8d76445f18b9e8605959a1c 13500 libedlib1_1.2.7-2_armhf.deb
365d2379b0318dfcd06cda89fbb2736dbc26d3f1cece838430d86a9b6ed34ae2 8724 libedlib_1.2.7-2_armhf.buildinfo
6c3b71f5f466e6954dac80a0157a4ba97fc3ba42b44a5b3b4b23269ba9387e21 268436 python3-edlib-dbgsym_1.2.7-2_armhf.deb
4c5f275075b6e82dc9a8d8df152590258b8d9badc0592dccb6f4575ac772f5e4 49836 python3-edlib_1.2.7-2_armhf.deb
Files:
edf20c944ac446d57cf02475a3476614 117048 debug optional edlib-aligner-dbgsym_1.2.7-2_armhf.deb
0b2dcc97935d2fe4c857effa88966ff7 19612 science optional edlib-aligner_1.2.7-2_armhf.deb
2acb26dfd5383092dae61b1a54a28227 18680 libdevel optional libedlib-dev_1.2.7-2_armhf.deb
a77dfdc0a4d07a138c90be697a1dd894 74400 debug optional libedlib1-dbgsym_1.2.7-2_armhf.deb
add596d40dff1fb00eccdf7eb855a63d 13500 libs optional libedlib1_1.2.7-2_armhf.deb
f869e4559535a5c584ba8672a01f39dc 8724 science optional libedlib_1.2.7-2_armhf.buildinfo
e37d086e257e92e135f547c04544806c 268436 debug optional python3-edlib-dbgsym_1.2.7-2_armhf.deb
12a9ad120b59457b0168ed579d8af052 49836 python optional python3-edlib_1.2.7-2_armhf.deb
+------------------------------------------------------------------------------+
| Package contents |
+------------------------------------------------------------------------------+
edlib-aligner-dbgsym_1.2.7-2_armhf.deb
--------------------------------------
new Debian package, version 2.0.
size 117048 bytes: control archive=544 bytes.
389 bytes, 12 lines control
106 bytes, 1 lines md5sums
Package: edlib-aligner-dbgsym
Source: libedlib
Version: 1.2.7-2
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 129
Depends: edlib-aligner (= 1.2.7-2)
Section: debug
Priority: optional
Description: debug symbols for edlib-aligner
Build-Ids: bbd4c9dd11b6c97e785c64fb808871518299c8c2
drwxr-xr-x root/root 0 2021-10-14 07:27 ./
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/debug/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/debug/.build-id/bb/
-rw-r--r-- root/root 120944 2021-10-14 07:27 ./usr/lib/debug/.build-id/bb/d4c9dd11b6c97e785c64fb808871518299c8c2.debug
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/
lrwxrwxrwx root/root 0 2021-10-14 07:27 ./usr/share/doc/edlib-aligner-dbgsym -> edlib-aligner
edlib-aligner_1.2.7-2_armhf.deb
-------------------------------
new Debian package, version 2.0.
size 19612 bytes: control archive=1284 bytes.
1414 bytes, 31 lines control
545 bytes, 7 lines md5sums
Package: edlib-aligner
Source: libedlib
Version: 1.2.7-2
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 53
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2), libedlib1 (= 1.2.7-2)
Section: science
Priority: optional
Homepage: https://github.com/Martinsos/edlib
Description: edlib sequence alignment tool using edit distance
Edlib is a lightweight and super fast C/C++ library for sequence
alignment using edit distance. This package provides an aligner
using this library.
.
Features of libedlib
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
drwxr-xr-x root/root 0 2021-10-14 07:27 ./
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/bin/
-rwxr-xr-x root/root 34312 2021-10-14 07:27 ./usr/bin/edlib-aligner
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/edlib-aligner/
-rw-r--r-- root/root 1026 2021-10-14 07:27 ./usr/share/doc/edlib-aligner/changelog.Debian.gz
-rw-r--r-- root/root 1343 2021-10-14 07:27 ./usr/share/doc/edlib-aligner/copyright
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/edlib-aligner/examples/
drwxr-xr-x root/root 0 2021-08-20 22:00 ./usr/share/doc/edlib-aligner/examples/test_data/
-rw-r--r-- root/root 112 2021-08-20 22:00 ./usr/share/doc/edlib-aligner/examples/test_data/query.fasta
-rw-r--r-- root/root 111 2021-08-20 22:00 ./usr/share/doc/edlib-aligner/examples/test_data/target.fasta
-rw-r--r-- root/root 334 2021-10-14 07:27 ./usr/share/doc/edlib-aligner/run-unit-test
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/man/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/man/man1/
-rw-r--r-- root/root 815 2021-10-14 07:27 ./usr/share/man/man1/edlib-aligner.1.gz
libedlib-dev_1.2.7-2_armhf.deb
------------------------------
new Debian package, version 2.0.
size 18680 bytes: control archive=1396 bytes.
1528 bytes, 37 lines control
752 bytes, 9 lines md5sums
Package: libedlib-dev
Source: libedlib
Version: 1.2.7-2
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 62
Depends: libedlib1 (= 1.2.7-2)
Section: libdevel
Priority: optional
Multi-Arch: same
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance (devel)
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the static library and the header files.
drwxr-xr-x root/root 0 2021-10-14 07:27 ./
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/include/
-rw-r--r-- root/root 11041 2021-08-20 22:00 ./usr/include/edlib.h
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/cmake/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/cmake/edlib/
-rw-r--r-- root/root 1977 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-config-version.cmake
-rw-r--r-- root/root 1356 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-config.cmake
-rw-r--r-- root/root 1395 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-targets-release.cmake
-rw-r--r-- root/root 3941 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/cmake/edlib/edlib-targets.cmake
-rw-r--r-- root/root 23378 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/libedlib.a
lrwxrwxrwx root/root 0 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/libedlib.so -> libedlib.so.1
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/pkgconfig/
-rw-r--r-- root/root 237 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/pkgconfig/edlib-1.pc
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/libedlib-dev/
-rw-r--r-- root/root 1026 2021-10-14 07:27 ./usr/share/doc/libedlib-dev/changelog.Debian.gz
-rw-r--r-- root/root 1343 2021-10-14 07:27 ./usr/share/doc/libedlib-dev/copyright
libedlib1-dbgsym_1.2.7-2_armhf.deb
----------------------------------
new Debian package, version 2.0.
size 74400 bytes: control archive=548 bytes.
393 bytes, 13 lines control
106 bytes, 1 lines md5sums
Package: libedlib1-dbgsym
Source: libedlib
Version: 1.2.7-2
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 86
Depends: libedlib1 (= 1.2.7-2)
Section: debug
Priority: optional
Multi-Arch: same
Description: debug symbols for libedlib1
Build-Ids: 30b4fd4f6253679d12dabb946d46fe0307561f1b
drwxr-xr-x root/root 0 2021-10-14 07:27 ./
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/debug/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/debug/.build-id/30/
-rw-r--r-- root/root 76836 2021-10-14 07:27 ./usr/lib/debug/.build-id/30/b4fd4f6253679d12dabb946d46fe0307561f1b.debug
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/
lrwxrwxrwx root/root 0 2021-10-14 07:27 ./usr/share/doc/libedlib1-dbgsym -> libedlib1
libedlib1_1.2.7-2_armhf.deb
---------------------------
new Debian package, version 2.0.
size 13500 bytes: control archive=1316 bytes.
1526 bytes, 37 lines control
226 bytes, 3 lines md5sums
32 bytes, 1 lines shlibs
67 bytes, 2 lines triggers
Package: libedlib1
Source: libedlib
Version: 1.2.7-2
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 37
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2)
Section: libs
Priority: optional
Multi-Arch: same
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the shared library.
drwxr-xr-x root/root 0 2021-10-14 07:27 ./
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/
lrwxrwxrwx root/root 0 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/libedlib.so.1 -> libedlib.so.1.2.6
-rw-r--r-- root/root 21864 2021-10-14 07:27 ./usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.6
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/libedlib1/
-rw-r--r-- root/root 1026 2021-10-14 07:27 ./usr/share/doc/libedlib1/changelog.Debian.gz
-rw-r--r-- root/root 1343 2021-10-14 07:27 ./usr/share/doc/libedlib1/copyright
python3-edlib-dbgsym_1.2.7-2_armhf.deb
--------------------------------------
new Debian package, version 2.0.
size 268436 bytes: control archive=556 bytes.
406 bytes, 13 lines control
106 bytes, 1 lines md5sums
Package: python3-edlib-dbgsym
Source: libedlib
Version: 1.2.7-2
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 296
Depends: python3-edlib (= 1.2.7-2)
Section: debug
Priority: optional
Multi-Arch: same
Description: debug symbols for python3-edlib
Build-Ids: 6d0e6d3bfc53a55387064fe59393a4ecacd058bc
drwxr-xr-x root/root 0 2021-10-14 07:27 ./
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/debug/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/debug/.build-id/6d/
-rw-r--r-- root/root 292404 2021-10-14 07:27 ./usr/lib/debug/.build-id/6d/0e6d3bfc53a55387064fe59393a4ecacd058bc.debug
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/
lrwxrwxrwx root/root 0 2021-10-14 07:27 ./usr/share/doc/python3-edlib-dbgsym -> python3-edlib
python3-edlib_1.2.7-2_armhf.deb
-------------------------------
new Debian package, version 2.0.
size 49836 bytes: control archive=1380 bytes.
1588 bytes, 37 lines control
575 bytes, 6 lines md5sums
Package: python3-edlib
Source: libedlib
Version: 1.2.7-2
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 142
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2), python3 (<< 3.10), python3 (>= 3.9~)
Section: python
Priority: optional
Multi-Arch: same
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance (Python3 module)
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the Python3 module.
drwxr-xr-x root/root 0 2021-10-14 07:27 ./
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/python3/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/python3/dist-packages/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/lib/python3/dist-packages/edlib-1.3.8.post2.egg-info/
-rw-r--r-- root/root 365 2021-10-14 07:27 ./usr/lib/python3/dist-packages/edlib-1.3.8.post2.egg-info/PKG-INFO
-rw-r--r-- root/root 1 2021-10-14 07:27 ./usr/lib/python3/dist-packages/edlib-1.3.8.post2.egg-info/dependency_links.txt
-rw-r--r-- root/root 6 2021-10-14 07:27 ./usr/lib/python3/dist-packages/edlib-1.3.8.post2.egg-info/top_level.txt
-rw-r--r-- root/root 127872 2021-10-14 07:27 ./usr/lib/python3/dist-packages/edlib.cpython-39-arm-linux-gnueabihf.so
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/
drwxr-xr-x root/root 0 2021-10-14 07:27 ./usr/share/doc/python3-edlib/
-rw-r--r-- root/root 1026 2021-10-14 07:27 ./usr/share/doc/python3-edlib/changelog.Debian.gz
-rw-r--r-- root/root 1343 2021-10-14 07:27 ./usr/share/doc/python3-edlib/copyright
+------------------------------------------------------------------------------+
| Post Build |
+------------------------------------------------------------------------------+
+------------------------------------------------------------------------------+
| Cleanup |
+------------------------------------------------------------------------------+
Purging /<<BUILDDIR>>
Not cleaning session: cloned chroot in use
+------------------------------------------------------------------------------+
| Summary |
+------------------------------------------------------------------------------+
Build Architecture: armhf
Build-Space: 20900
Build-Time: 159
Distribution: bookworm-staging
Host Architecture: armhf
Install-Time: 665
Job: libedlib_1.2.7-2
Machine Architecture: armhf
Package: libedlib
Package-Time: 875
Source-Version: 1.2.7-2
Space: 20900
Status: successful
Version: 1.2.7-2
--------------------------------------------------------------------------------
Finished at 2021-10-16T08:27:36Z
Build needed 00:14:35, 20900k disc space