libedlib →
1.2.6-1 →
armhf → 2021-01-15 12:41:20
sbuild (Debian sbuild) 0.78.1 (09 February 2019) on test2019
+==============================================================================+
| libedlib 1.2.6-1 (armhf) Fri, 15 Jan 2021 12:32:43 +0000 |
+==============================================================================+
Package: libedlib
Version: 1.2.6-1
Source Version: 1.2.6-1
Distribution: bullseye-staging
Machine Architecture: armhf
Host Architecture: armhf
Build Architecture: armhf
Build Type: any
I: NOTICE: Log filtering will replace 'var/run/schroot/mount/bullseye-staging-armhf-sbuild-e71d495a-25ef-4340-a0ea-15b7014ed96e' with '<<CHROOT>>'
I: NOTICE: Log filtering will replace 'build/libedlib-PnbiTU/resolver-bSxxVL' with '<<RESOLVERDIR>>'
+------------------------------------------------------------------------------+
| Update chroot |
+------------------------------------------------------------------------------+
Get:1 http://172.17.0.1/private bullseye-staging InRelease [11.3 kB]
Get:2 http://172.17.0.1/private bullseye-staging/main Sources [12.1 MB]
Get:3 http://172.17.0.1/private bullseye-staging/main armhf Packages [13.1 MB]
Fetched 25.2 MB in 12s (2051 kB/s)
Reading package lists...
+------------------------------------------------------------------------------+
| Fetch source files |
+------------------------------------------------------------------------------+
Check APT
---------
Checking available source versions...
Download source files with APT
------------------------------
Reading package lists...
NOTICE: 'libedlib' packaging is maintained in the 'Git' version control system at:
https://salsa.debian.org/med-team/libedlib.git
Please use:
git clone https://salsa.debian.org/med-team/libedlib.git
to retrieve the latest (possibly unreleased) updates to the package.
Need to get 4320 kB of source archives.
Get:1 http://172.17.0.1/private bullseye-staging/main libedlib 1.2.6-1 (dsc) [2221 B]
Get:2 http://172.17.0.1/private bullseye-staging/main libedlib 1.2.6-1 (tar) [4312 kB]
Get:3 http://172.17.0.1/private bullseye-staging/main libedlib 1.2.6-1 (diff) [6596 B]
Fetched 4320 kB in 1s (5912 kB/s)
Download complete and in download only mode
I: NOTICE: Log filtering will replace 'build/libedlib-PnbiTU/libedlib-1.2.6' with '<<PKGBUILDDIR>>'
I: NOTICE: Log filtering will replace 'build/libedlib-PnbiTU' with '<<BUILDDIR>>'
+------------------------------------------------------------------------------+
| Install package build dependencies |
+------------------------------------------------------------------------------+
Setup apt archive
-----------------
Merged Build-Depends: debhelper-compat (= 12), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools, build-essential, fakeroot
Filtered Build-Depends: debhelper-compat (= 12), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools, build-essential, fakeroot
dpkg-deb: building package 'sbuild-build-depends-main-dummy' in '/<<RESOLVERDIR>>/apt_archive/sbuild-build-depends-main-dummy.deb'.
Ign:1 copy:/<<RESOLVERDIR>>/apt_archive ./ InRelease
Get:2 copy:/<<RESOLVERDIR>>/apt_archive ./ Release [957 B]
Ign:3 copy:/<<RESOLVERDIR>>/apt_archive ./ Release.gpg
Get:4 copy:/<<RESOLVERDIR>>/apt_archive ./ Sources [412 B]
Get:5 copy:/<<RESOLVERDIR>>/apt_archive ./ Packages [496 B]
Fetched 1865 B in 0s (35.1 kB/s)
Reading package lists...
Reading package lists...
Install main build dependencies (apt-based resolver)
----------------------------------------------------
Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following additional packages will be installed:
autoconf automake autopoint autotools-dev bsdextrautils cmake cmake-data
cython3 d-shlibs debhelper dh-autoreconf dh-python dh-strip-nondeterminism
dwz file gettext gettext-base groff-base intltool-debian libarchive-zip-perl
libarchive13 libbrotli1 libcurl4 libdebhelper-perl libelf1 libexpat1
libexpat1-dev libfile-stripnondeterminism-perl libicu67 libjsoncpp24
libmagic-mgc libmagic1 libncurses6 libncursesw6 libnghttp2-14 libpipeline1
libprocps8 libpsl5 libpython3-all-dev libpython3-dev libpython3-stdlib
libpython3.9 libpython3.9-dev libpython3.9-minimal libpython3.9-stdlib
librhash0 librtmp1 libsigsegv2 libssh2-1 libsub-override-perl libtinfo6
libtool libuchardet0 libuv1 libxml2 m4 mailcap man-db media-types
mime-support po-debconf procps python3 python3-all python3-all-dev
python3-dev python3-distutils python3-lib2to3 python3-minimal
python3-pkg-resources python3-setuptools python3.9 python3.9-dev
python3.9-minimal rename sensible-utils zlib1g-dev
Suggested packages:
autoconf-archive gnu-standards autoconf-doc cmake-doc ninja-build cython-doc
dh-make gettext-doc libasprintf-dev libgettextpo-dev groff lrzip libtool-doc
gfortran | fortran95-compiler gcj-jdk m4-doc apparmor less www-browser
libmail-box-perl python3-doc python3-tk python3-venv python-setuptools-doc
python3.9-venv python3.9-doc binfmt-support
Recommended packages:
curl | wget | lynx ca-certificates libarchive-cpio-perl libgpm2 publicsuffix
libltdl-dev libmail-sendmail-perl psmisc libio-stringy-perl
libpod-parser-perl
The following NEW packages will be installed:
autoconf automake autopoint autotools-dev bsdextrautils cmake cmake-data
cython3 d-shlibs debhelper dh-autoreconf dh-python dh-strip-nondeterminism
dwz file gettext gettext-base groff-base intltool-debian libarchive-zip-perl
libarchive13 libbrotli1 libcurl4 libdebhelper-perl libelf1 libexpat1
libexpat1-dev libfile-stripnondeterminism-perl libicu67 libjsoncpp24
libmagic-mgc libmagic1 libncurses6 libnghttp2-14 libpipeline1 libprocps8
libpsl5 libpython3-all-dev libpython3-dev libpython3-stdlib libpython3.9
libpython3.9-dev libpython3.9-minimal libpython3.9-stdlib librhash0 librtmp1
libsigsegv2 libssh2-1 libsub-override-perl libtool libuchardet0 libuv1
libxml2 m4 mailcap man-db media-types mime-support po-debconf procps python3
python3-all python3-all-dev python3-dev python3-distutils python3-lib2to3
python3-minimal python3-pkg-resources python3-setuptools python3.9
python3.9-dev python3.9-minimal rename sbuild-build-depends-main-dummy
sensible-utils zlib1g-dev
The following packages will be upgraded:
libncursesw6 libtinfo6
2 upgraded, 76 newly installed, 0 to remove and 50 not upgraded.
Need to get 37.5 MB of archives.
After this operation, 149 MB of additional disk space will be used.
Get:1 copy:/<<RESOLVERDIR>>/apt_archive ./ sbuild-build-depends-main-dummy 0.invalid.0 [912 B]
Get:2 http://172.17.0.1/private bullseye-staging/main armhf bsdextrautils armhf 2.36.1-4 [137 kB]
Get:3 http://172.17.0.1/private bullseye-staging/main armhf libuchardet0 armhf 0.0.7-1 [65.0 kB]
Get:4 http://172.17.0.1/private bullseye-staging/main armhf groff-base armhf 1.22.4-5 [783 kB]
Get:5 http://172.17.0.1/private bullseye-staging/main armhf libpipeline1 armhf 1.5.3-1 [29.9 kB]
Get:6 http://172.17.0.1/private bullseye-staging/main armhf man-db armhf 2.9.3-2 [1269 kB]
Get:7 http://172.17.0.1/private bullseye-staging/main armhf libpython3.9-minimal armhf 3.9.1-1+rpi1 [789 kB]
Get:8 http://172.17.0.1/private bullseye-staging/main armhf libexpat1 armhf 2.2.10-1 [73.3 kB]
Get:9 http://172.17.0.1/private bullseye-staging/main armhf python3.9-minimal armhf 3.9.1-1+rpi1 [1625 kB]
Get:10 http://172.17.0.1/private bullseye-staging/main armhf python3-minimal armhf 3.9.1-1 [37.8 kB]
Get:11 http://172.17.0.1/private bullseye-staging/main armhf media-types all 1.1.0 [19.0 kB]
Get:12 http://172.17.0.1/private bullseye-staging/main armhf mailcap all 3.68 [31.6 kB]
Get:13 http://172.17.0.1/private bullseye-staging/main armhf mime-support all 3.66 [10.9 kB]
Get:14 http://172.17.0.1/private bullseye-staging/main armhf libtinfo6 armhf 6.2+20201114-2 [328 kB]
Get:15 http://172.17.0.1/private bullseye-staging/main armhf libncursesw6 armhf 6.2+20201114-2 [105 kB]
Get:16 http://172.17.0.1/private bullseye-staging/main armhf libpython3.9-stdlib armhf 3.9.1-1+rpi1 [1654 kB]
Get:17 http://172.17.0.1/private bullseye-staging/main armhf python3.9 armhf 3.9.1-1+rpi1 [461 kB]
Get:18 http://172.17.0.1/private bullseye-staging/main armhf libpython3-stdlib armhf 3.9.1-1 [21.0 kB]
Get:19 http://172.17.0.1/private bullseye-staging/main armhf python3 armhf 3.9.1-1 [64.1 kB]
Get:20 http://172.17.0.1/private bullseye-staging/main armhf libncurses6 armhf 6.2+20201114-2 [79.9 kB]
Get:21 http://172.17.0.1/private bullseye-staging/main armhf libprocps8 armhf 2:3.3.16-5 [59.8 kB]
Get:22 http://172.17.0.1/private bullseye-staging/main armhf procps armhf 2:3.3.16-5 [238 kB]
Get:23 http://172.17.0.1/private bullseye-staging/main armhf sensible-utils all 0.0.14 [14.8 kB]
Get:24 http://172.17.0.1/private bullseye-staging/main armhf libmagic-mgc armhf 1:5.39-3 [273 kB]
Get:25 http://172.17.0.1/private bullseye-staging/main armhf libmagic1 armhf 1:5.39-3 [117 kB]
Get:26 http://172.17.0.1/private bullseye-staging/main armhf file armhf 1:5.39-3 [68.0 kB]
Get:27 http://172.17.0.1/private bullseye-staging/main armhf gettext-base armhf 0.21-3 [170 kB]
Get:28 http://172.17.0.1/private bullseye-staging/main armhf libsigsegv2 armhf 2.12-3 [32.4 kB]
Get:29 http://172.17.0.1/private bullseye-staging/main armhf m4 armhf 1.4.18-5 [186 kB]
Get:30 http://172.17.0.1/private bullseye-staging/main armhf autoconf all 2.69-14 [313 kB]
Get:31 http://172.17.0.1/private bullseye-staging/main armhf autotools-dev all 20180224.1+nmu1 [77.1 kB]
Get:32 http://172.17.0.1/private bullseye-staging/main armhf automake all 1:1.16.3-2 [814 kB]
Get:33 http://172.17.0.1/private bullseye-staging/main armhf autopoint all 0.21-3 [509 kB]
Get:34 http://172.17.0.1/private bullseye-staging/main armhf cmake-data all 3.18.4-1+rpi1 [1725 kB]
Get:35 http://172.17.0.1/private bullseye-staging/main armhf libicu67 armhf 67.1-5 [8288 kB]
Get:36 http://172.17.0.1/private bullseye-staging/main armhf libxml2 armhf 2.9.10+dfsg-6.3 [580 kB]
Get:37 http://172.17.0.1/private bullseye-staging/main armhf libarchive13 armhf 3.4.3-2 [294 kB]
Get:38 http://172.17.0.1/private bullseye-staging/main armhf libbrotli1 armhf 1.0.9-2+b1 [261 kB]
Get:39 http://172.17.0.1/private bullseye-staging/main armhf libnghttp2-14 armhf 1.42.0-1 [66.7 kB]
Get:40 http://172.17.0.1/private bullseye-staging/main armhf libpsl5 armhf 0.21.0-1.1 [54.2 kB]
Get:41 http://172.17.0.1/private bullseye-staging/main armhf librtmp1 armhf 2.4+20151223.gitfa8646d.1-2+b2 [54.2 kB]
Get:42 http://172.17.0.1/private bullseye-staging/main armhf libssh2-1 armhf 1.9.0-2 [141 kB]
Get:43 http://172.17.0.1/private bullseye-staging/main armhf libcurl4 armhf 7.74.0-1 [305 kB]
Get:44 http://172.17.0.1/private bullseye-staging/main armhf libjsoncpp24 armhf 1.9.4-4 [67.0 kB]
Get:45 http://172.17.0.1/private bullseye-staging/main armhf librhash0 armhf 1.4.1-1 [140 kB]
Get:46 http://172.17.0.1/private bullseye-staging/main armhf libuv1 armhf 1.40.0-1 [118 kB]
Get:47 http://172.17.0.1/private bullseye-staging/main armhf cmake armhf 3.18.4-1+rpi1+b1 [3111 kB]
Get:48 http://172.17.0.1/private bullseye-staging/main armhf cython3 armhf 0.29.21-3+b1 [1234 kB]
Get:49 http://172.17.0.1/private bullseye-staging/main armhf d-shlibs all 0.98 [17.9 kB]
Get:50 http://172.17.0.1/private bullseye-staging/main armhf libtool all 2.4.6-15 [513 kB]
Get:51 http://172.17.0.1/private bullseye-staging/main armhf dh-autoreconf all 19 [16.9 kB]
Get:52 http://172.17.0.1/private bullseye-staging/main armhf libdebhelper-perl all 13.3.1 [188 kB]
Get:53 http://172.17.0.1/private bullseye-staging/main armhf libarchive-zip-perl all 1.68-1 [104 kB]
Get:54 http://172.17.0.1/private bullseye-staging/main armhf libsub-override-perl all 0.09-2 [10.2 kB]
Get:55 http://172.17.0.1/private bullseye-staging/main armhf libfile-stripnondeterminism-perl all 1.9.0-1 [25.5 kB]
Get:56 http://172.17.0.1/private bullseye-staging/main armhf dh-strip-nondeterminism all 1.9.0-1 [15.2 kB]
Get:57 http://172.17.0.1/private bullseye-staging/main armhf libelf1 armhf 0.182-3 [162 kB]
Get:58 http://172.17.0.1/private bullseye-staging/main armhf dwz armhf 0.13+20201015-2 [162 kB]
Get:59 http://172.17.0.1/private bullseye-staging/main armhf gettext armhf 0.21-3 [1214 kB]
Get:60 http://172.17.0.1/private bullseye-staging/main armhf intltool-debian all 0.35.0+20060710.5 [26.8 kB]
Get:61 http://172.17.0.1/private bullseye-staging/main armhf po-debconf all 1.0.21+nmu1 [248 kB]
Get:62 http://172.17.0.1/private bullseye-staging/main armhf debhelper all 13.3.1 [1010 kB]
Get:63 http://172.17.0.1/private bullseye-staging/main armhf python3-lib2to3 all 3.9.1-2 [77.2 kB]
Get:64 http://172.17.0.1/private bullseye-staging/main armhf python3-distutils all 3.9.1-2 [143 kB]
Get:65 http://172.17.0.1/private bullseye-staging/main armhf dh-python all 4.20201102 [99.3 kB]
Get:66 http://172.17.0.1/private bullseye-staging/main armhf libexpat1-dev armhf 2.2.10-1 [121 kB]
Get:67 http://172.17.0.1/private bullseye-staging/main armhf libpython3.9 armhf 3.9.1-1+rpi1 [1411 kB]
Get:68 http://172.17.0.1/private bullseye-staging/main armhf libpython3.9-dev armhf 3.9.1-1+rpi1 [3053 kB]
Get:69 http://172.17.0.1/private bullseye-staging/main armhf libpython3-dev armhf 3.9.1-1 [21.2 kB]
Get:70 http://172.17.0.1/private bullseye-staging/main armhf libpython3-all-dev armhf 3.9.1-1 [1068 B]
Get:71 http://172.17.0.1/private bullseye-staging/main armhf python3-all armhf 3.9.1-1 [1056 B]
Get:72 http://172.17.0.1/private bullseye-staging/main armhf zlib1g-dev armhf 1:1.2.11.dfsg-2 [184 kB]
Get:73 http://172.17.0.1/private bullseye-staging/main armhf python3.9-dev armhf 3.9.1-1+rpi1 [501 kB]
Get:74 http://172.17.0.1/private bullseye-staging/main armhf python3-dev armhf 3.9.1-1 [1168 B]
Get:75 http://172.17.0.1/private bullseye-staging/main armhf python3-all-dev armhf 3.9.1-1 [1064 B]
Get:76 http://172.17.0.1/private bullseye-staging/main armhf python3-pkg-resources all 51.1.0-1 [203 kB]
Get:77 http://172.17.0.1/private bullseye-staging/main armhf python3-setuptools all 51.1.0-1 [1099 kB]
Get:78 http://172.17.0.1/private bullseye-staging/main armhf rename all 1.13-1 [18.0 kB]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 37.5 MB in 6s (6718 kB/s)
Selecting previously unselected package bsdextrautils.
(Reading database ... 12455 files and directories currently installed.)
Preparing to unpack .../0-bsdextrautils_2.36.1-4_armhf.deb ...
Unpacking bsdextrautils (2.36.1-4) ...
Selecting previously unselected package libuchardet0:armhf.
Preparing to unpack .../1-libuchardet0_0.0.7-1_armhf.deb ...
Unpacking libuchardet0:armhf (0.0.7-1) ...
Selecting previously unselected package groff-base.
Preparing to unpack .../2-groff-base_1.22.4-5_armhf.deb ...
Unpacking groff-base (1.22.4-5) ...
Selecting previously unselected package libpipeline1:armhf.
Preparing to unpack .../3-libpipeline1_1.5.3-1_armhf.deb ...
Unpacking libpipeline1:armhf (1.5.3-1) ...
Selecting previously unselected package man-db.
Preparing to unpack .../4-man-db_2.9.3-2_armhf.deb ...
Unpacking man-db (2.9.3-2) ...
Selecting previously unselected package libpython3.9-minimal:armhf.
Preparing to unpack .../5-libpython3.9-minimal_3.9.1-1+rpi1_armhf.deb ...
Unpacking libpython3.9-minimal:armhf (3.9.1-1+rpi1) ...
Selecting previously unselected package libexpat1:armhf.
Preparing to unpack .../6-libexpat1_2.2.10-1_armhf.deb ...
Unpacking libexpat1:armhf (2.2.10-1) ...
Selecting previously unselected package python3.9-minimal.
Preparing to unpack .../7-python3.9-minimal_3.9.1-1+rpi1_armhf.deb ...
Unpacking python3.9-minimal (3.9.1-1+rpi1) ...
Setting up libpython3.9-minimal:armhf (3.9.1-1+rpi1) ...
Setting up libexpat1:armhf (2.2.10-1) ...
Setting up python3.9-minimal (3.9.1-1+rpi1) ...
Selecting previously unselected package python3-minimal.
(Reading database ... 13306 files and directories currently installed.)
Preparing to unpack .../python3-minimal_3.9.1-1_armhf.deb ...
Unpacking python3-minimal (3.9.1-1) ...
Selecting previously unselected package media-types.
Preparing to unpack .../media-types_1.1.0_all.deb ...
Unpacking media-types (1.1.0) ...
Selecting previously unselected package mailcap.
Preparing to unpack .../archives/mailcap_3.68_all.deb ...
Unpacking mailcap (3.68) ...
Selecting previously unselected package mime-support.
Preparing to unpack .../mime-support_3.66_all.deb ...
Unpacking mime-support (3.66) ...
Preparing to unpack .../libtinfo6_6.2+20201114-2_armhf.deb ...
Unpacking libtinfo6:armhf (6.2+20201114-2) over (6.2+20201114-1) ...
Setting up libtinfo6:armhf (6.2+20201114-2) ...
(Reading database ... 13358 files and directories currently installed.)
Preparing to unpack .../libncursesw6_6.2+20201114-2_armhf.deb ...
Unpacking libncursesw6:armhf (6.2+20201114-2) over (6.2+20201114-1) ...
Setting up libncursesw6:armhf (6.2+20201114-2) ...
Selecting previously unselected package libpython3.9-stdlib:armhf.
(Reading database ... 13358 files and directories currently installed.)
Preparing to unpack .../libpython3.9-stdlib_3.9.1-1+rpi1_armhf.deb ...
Unpacking libpython3.9-stdlib:armhf (3.9.1-1+rpi1) ...
Selecting previously unselected package python3.9.
Preparing to unpack .../python3.9_3.9.1-1+rpi1_armhf.deb ...
Unpacking python3.9 (3.9.1-1+rpi1) ...
Selecting previously unselected package libpython3-stdlib:armhf.
Preparing to unpack .../libpython3-stdlib_3.9.1-1_armhf.deb ...
Unpacking libpython3-stdlib:armhf (3.9.1-1) ...
Setting up python3-minimal (3.9.1-1) ...
Selecting previously unselected package python3.
(Reading database ... 13719 files and directories currently installed.)
Preparing to unpack .../00-python3_3.9.1-1_armhf.deb ...
Unpacking python3 (3.9.1-1) ...
Selecting previously unselected package libncurses6:armhf.
Preparing to unpack .../01-libncurses6_6.2+20201114-2_armhf.deb ...
Unpacking libncurses6:armhf (6.2+20201114-2) ...
Selecting previously unselected package libprocps8:armhf.
Preparing to unpack .../02-libprocps8_2%3a3.3.16-5_armhf.deb ...
Unpacking libprocps8:armhf (2:3.3.16-5) ...
Selecting previously unselected package procps.
Preparing to unpack .../03-procps_2%3a3.3.16-5_armhf.deb ...
Unpacking procps (2:3.3.16-5) ...
Selecting previously unselected package sensible-utils.
Preparing to unpack .../04-sensible-utils_0.0.14_all.deb ...
Unpacking sensible-utils (0.0.14) ...
Selecting previously unselected package libmagic-mgc.
Preparing to unpack .../05-libmagic-mgc_1%3a5.39-3_armhf.deb ...
Unpacking libmagic-mgc (1:5.39-3) ...
Selecting previously unselected package libmagic1:armhf.
Preparing to unpack .../06-libmagic1_1%3a5.39-3_armhf.deb ...
Unpacking libmagic1:armhf (1:5.39-3) ...
Selecting previously unselected package file.
Preparing to unpack .../07-file_1%3a5.39-3_armhf.deb ...
Unpacking file (1:5.39-3) ...
Selecting previously unselected package gettext-base.
Preparing to unpack .../08-gettext-base_0.21-3_armhf.deb ...
Unpacking gettext-base (0.21-3) ...
Selecting previously unselected package libsigsegv2:armhf.
Preparing to unpack .../09-libsigsegv2_2.12-3_armhf.deb ...
Unpacking libsigsegv2:armhf (2.12-3) ...
Selecting previously unselected package m4.
Preparing to unpack .../10-m4_1.4.18-5_armhf.deb ...
Unpacking m4 (1.4.18-5) ...
Selecting previously unselected package autoconf.
Preparing to unpack .../11-autoconf_2.69-14_all.deb ...
Unpacking autoconf (2.69-14) ...
Selecting previously unselected package autotools-dev.
Preparing to unpack .../12-autotools-dev_20180224.1+nmu1_all.deb ...
Unpacking autotools-dev (20180224.1+nmu1) ...
Selecting previously unselected package automake.
Preparing to unpack .../13-automake_1%3a1.16.3-2_all.deb ...
Unpacking automake (1:1.16.3-2) ...
Selecting previously unselected package autopoint.
Preparing to unpack .../14-autopoint_0.21-3_all.deb ...
Unpacking autopoint (0.21-3) ...
Selecting previously unselected package cmake-data.
Preparing to unpack .../15-cmake-data_3.18.4-1+rpi1_all.deb ...
Unpacking cmake-data (3.18.4-1+rpi1) ...
Selecting previously unselected package libicu67:armhf.
Preparing to unpack .../16-libicu67_67.1-5_armhf.deb ...
Unpacking libicu67:armhf (67.1-5) ...
Selecting previously unselected package libxml2:armhf.
Preparing to unpack .../17-libxml2_2.9.10+dfsg-6.3_armhf.deb ...
Unpacking libxml2:armhf (2.9.10+dfsg-6.3) ...
Selecting previously unselected package libarchive13:armhf.
Preparing to unpack .../18-libarchive13_3.4.3-2_armhf.deb ...
Unpacking libarchive13:armhf (3.4.3-2) ...
Selecting previously unselected package libbrotli1:armhf.
Preparing to unpack .../19-libbrotli1_1.0.9-2+b1_armhf.deb ...
Unpacking libbrotli1:armhf (1.0.9-2+b1) ...
Selecting previously unselected package libnghttp2-14:armhf.
Preparing to unpack .../20-libnghttp2-14_1.42.0-1_armhf.deb ...
Unpacking libnghttp2-14:armhf (1.42.0-1) ...
Selecting previously unselected package libpsl5:armhf.
Preparing to unpack .../21-libpsl5_0.21.0-1.1_armhf.deb ...
Unpacking libpsl5:armhf (0.21.0-1.1) ...
Selecting previously unselected package librtmp1:armhf.
Preparing to unpack .../22-librtmp1_2.4+20151223.gitfa8646d.1-2+b2_armhf.deb ...
Unpacking librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b2) ...
Selecting previously unselected package libssh2-1:armhf.
Preparing to unpack .../23-libssh2-1_1.9.0-2_armhf.deb ...
Unpacking libssh2-1:armhf (1.9.0-2) ...
Selecting previously unselected package libcurl4:armhf.
Preparing to unpack .../24-libcurl4_7.74.0-1_armhf.deb ...
Unpacking libcurl4:armhf (7.74.0-1) ...
Selecting previously unselected package libjsoncpp24:armhf.
Preparing to unpack .../25-libjsoncpp24_1.9.4-4_armhf.deb ...
Unpacking libjsoncpp24:armhf (1.9.4-4) ...
Selecting previously unselected package librhash0:armhf.
Preparing to unpack .../26-librhash0_1.4.1-1_armhf.deb ...
Unpacking librhash0:armhf (1.4.1-1) ...
Selecting previously unselected package libuv1:armhf.
Preparing to unpack .../27-libuv1_1.40.0-1_armhf.deb ...
Unpacking libuv1:armhf (1.40.0-1) ...
Selecting previously unselected package cmake.
Preparing to unpack .../28-cmake_3.18.4-1+rpi1+b1_armhf.deb ...
Unpacking cmake (3.18.4-1+rpi1+b1) ...
Selecting previously unselected package cython3.
Preparing to unpack .../29-cython3_0.29.21-3+b1_armhf.deb ...
Unpacking cython3 (0.29.21-3+b1) ...
Selecting previously unselected package d-shlibs.
Preparing to unpack .../30-d-shlibs_0.98_all.deb ...
Unpacking d-shlibs (0.98) ...
Selecting previously unselected package libtool.
Preparing to unpack .../31-libtool_2.4.6-15_all.deb ...
Unpacking libtool (2.4.6-15) ...
Selecting previously unselected package dh-autoreconf.
Preparing to unpack .../32-dh-autoreconf_19_all.deb ...
Unpacking dh-autoreconf (19) ...
Selecting previously unselected package libdebhelper-perl.
Preparing to unpack .../33-libdebhelper-perl_13.3.1_all.deb ...
Unpacking libdebhelper-perl (13.3.1) ...
Selecting previously unselected package libarchive-zip-perl.
Preparing to unpack .../34-libarchive-zip-perl_1.68-1_all.deb ...
Unpacking libarchive-zip-perl (1.68-1) ...
Selecting previously unselected package libsub-override-perl.
Preparing to unpack .../35-libsub-override-perl_0.09-2_all.deb ...
Unpacking libsub-override-perl (0.09-2) ...
Selecting previously unselected package libfile-stripnondeterminism-perl.
Preparing to unpack .../36-libfile-stripnondeterminism-perl_1.9.0-1_all.deb ...
Unpacking libfile-stripnondeterminism-perl (1.9.0-1) ...
Selecting previously unselected package dh-strip-nondeterminism.
Preparing to unpack .../37-dh-strip-nondeterminism_1.9.0-1_all.deb ...
Unpacking dh-strip-nondeterminism (1.9.0-1) ...
Selecting previously unselected package libelf1:armhf.
Preparing to unpack .../38-libelf1_0.182-3_armhf.deb ...
Unpacking libelf1:armhf (0.182-3) ...
Selecting previously unselected package dwz.
Preparing to unpack .../39-dwz_0.13+20201015-2_armhf.deb ...
Unpacking dwz (0.13+20201015-2) ...
Selecting previously unselected package gettext.
Preparing to unpack .../40-gettext_0.21-3_armhf.deb ...
Unpacking gettext (0.21-3) ...
Selecting previously unselected package intltool-debian.
Preparing to unpack .../41-intltool-debian_0.35.0+20060710.5_all.deb ...
Unpacking intltool-debian (0.35.0+20060710.5) ...
Selecting previously unselected package po-debconf.
Preparing to unpack .../42-po-debconf_1.0.21+nmu1_all.deb ...
Unpacking po-debconf (1.0.21+nmu1) ...
Selecting previously unselected package debhelper.
Preparing to unpack .../43-debhelper_13.3.1_all.deb ...
Unpacking debhelper (13.3.1) ...
Selecting previously unselected package python3-lib2to3.
Preparing to unpack .../44-python3-lib2to3_3.9.1-2_all.deb ...
Unpacking python3-lib2to3 (3.9.1-2) ...
Selecting previously unselected package python3-distutils.
Preparing to unpack .../45-python3-distutils_3.9.1-2_all.deb ...
Unpacking python3-distutils (3.9.1-2) ...
Selecting previously unselected package dh-python.
Preparing to unpack .../46-dh-python_4.20201102_all.deb ...
Unpacking dh-python (4.20201102) ...
Selecting previously unselected package libexpat1-dev:armhf.
Preparing to unpack .../47-libexpat1-dev_2.2.10-1_armhf.deb ...
Unpacking libexpat1-dev:armhf (2.2.10-1) ...
Selecting previously unselected package libpython3.9:armhf.
Preparing to unpack .../48-libpython3.9_3.9.1-1+rpi1_armhf.deb ...
Unpacking libpython3.9:armhf (3.9.1-1+rpi1) ...
Selecting previously unselected package libpython3.9-dev:armhf.
Preparing to unpack .../49-libpython3.9-dev_3.9.1-1+rpi1_armhf.deb ...
Unpacking libpython3.9-dev:armhf (3.9.1-1+rpi1) ...
Selecting previously unselected package libpython3-dev:armhf.
Preparing to unpack .../50-libpython3-dev_3.9.1-1_armhf.deb ...
Unpacking libpython3-dev:armhf (3.9.1-1) ...
Selecting previously unselected package libpython3-all-dev:armhf.
Preparing to unpack .../51-libpython3-all-dev_3.9.1-1_armhf.deb ...
Unpacking libpython3-all-dev:armhf (3.9.1-1) ...
Selecting previously unselected package python3-all.
Preparing to unpack .../52-python3-all_3.9.1-1_armhf.deb ...
Unpacking python3-all (3.9.1-1) ...
Selecting previously unselected package zlib1g-dev:armhf.
Preparing to unpack .../53-zlib1g-dev_1%3a1.2.11.dfsg-2_armhf.deb ...
Unpacking zlib1g-dev:armhf (1:1.2.11.dfsg-2) ...
Selecting previously unselected package python3.9-dev.
Preparing to unpack .../54-python3.9-dev_3.9.1-1+rpi1_armhf.deb ...
Unpacking python3.9-dev (3.9.1-1+rpi1) ...
Selecting previously unselected package python3-dev.
Preparing to unpack .../55-python3-dev_3.9.1-1_armhf.deb ...
Unpacking python3-dev (3.9.1-1) ...
Selecting previously unselected package python3-all-dev.
Preparing to unpack .../56-python3-all-dev_3.9.1-1_armhf.deb ...
Unpacking python3-all-dev (3.9.1-1) ...
Selecting previously unselected package python3-pkg-resources.
Preparing to unpack .../57-python3-pkg-resources_51.1.0-1_all.deb ...
Unpacking python3-pkg-resources (51.1.0-1) ...
Selecting previously unselected package python3-setuptools.
Preparing to unpack .../58-python3-setuptools_51.1.0-1_all.deb ...
Unpacking python3-setuptools (51.1.0-1) ...
Selecting previously unselected package rename.
Preparing to unpack .../59-rename_1.13-1_all.deb ...
Unpacking rename (1.13-1) ...
Selecting previously unselected package sbuild-build-depends-main-dummy.
Preparing to unpack .../60-sbuild-build-depends-main-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-main-dummy (0.invalid.0) ...
Setting up media-types (1.1.0) ...
Setting up libpipeline1:armhf (1.5.3-1) ...
Setting up libpsl5:armhf (0.21.0-1.1) ...
Setting up bsdextrautils (2.36.1-4) ...
update-alternatives: using /usr/bin/write.ul to provide /usr/bin/write (write) in auto mode
Setting up libicu67:armhf (67.1-5) ...
Setting up libmagic-mgc (1:5.39-3) ...
Setting up libarchive-zip-perl (1.68-1) ...
Setting up libdebhelper-perl (13.3.1) ...
Setting up libbrotli1:armhf (1.0.9-2+b1) ...
Setting up libnghttp2-14:armhf (1.42.0-1) ...
Setting up libmagic1:armhf (1:5.39-3) ...
Setting up gettext-base (0.21-3) ...
Setting up rename (1.13-1) ...
update-alternatives: using /usr/bin/file-rename to provide /usr/bin/rename (rename) in auto mode
Setting up file (1:5.39-3) ...
Setting up autotools-dev (20180224.1+nmu1) ...
Setting up libuv1:armhf (1.40.0-1) ...
Setting up libexpat1-dev:armhf (2.2.10-1) ...
Setting up librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b2) ...
Setting up libncurses6:armhf (6.2+20201114-2) ...
Setting up libsigsegv2:armhf (2.12-3) ...
Setting up autopoint (0.21-3) ...
Setting up d-shlibs (0.98) ...
Setting up libjsoncpp24:armhf (1.9.4-4) ...
Setting up zlib1g-dev:armhf (1:1.2.11.dfsg-2) ...
Setting up sensible-utils (0.0.14) ...
Setting up librhash0:armhf (1.4.1-1) ...
Setting up libuchardet0:armhf (0.0.7-1) ...
Setting up libsub-override-perl (0.09-2) ...
Setting up libssh2-1:armhf (1.9.0-2) ...
Setting up cmake-data (3.18.4-1+rpi1) ...
Setting up mailcap (3.68) ...
Setting up libelf1:armhf (0.182-3) ...
Setting up libxml2:armhf (2.9.10+dfsg-6.3) ...
Setting up libprocps8:armhf (2:3.3.16-5) ...
Setting up libpython3.9-stdlib:armhf (3.9.1-1+rpi1) ...
Setting up libpython3-stdlib:armhf (3.9.1-1) ...
Setting up libfile-stripnondeterminism-perl (1.9.0-1) ...
Setting up gettext (0.21-3) ...
Setting up mime-support (3.66) ...
Setting up libtool (2.4.6-15) ...
Setting up libarchive13:armhf (3.4.3-2) ...
Setting up m4 (1.4.18-5) ...
Setting up intltool-debian (0.35.0+20060710.5) ...
Setting up libpython3.9:armhf (3.9.1-1+rpi1) ...
Setting up autoconf (2.69-14) ...
Setting up dh-strip-nondeterminism (1.9.0-1) ...
Setting up dwz (0.13+20201015-2) ...
Setting up groff-base (1.22.4-5) ...
Setting up procps (2:3.3.16-5) ...
update-alternatives: using /usr/bin/w.procps to provide /usr/bin/w (w) in auto mode
Setting up libcurl4:armhf (7.74.0-1) ...
Setting up python3.9 (3.9.1-1+rpi1) ...
Setting up automake (1:1.16.3-2) ...
update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode
Setting up po-debconf (1.0.21+nmu1) ...
Setting up libpython3.9-dev:armhf (3.9.1-1+rpi1) ...
Setting up python3 (3.9.1-1) ...
Setting up man-db (2.9.3-2) ...
Not building database; man-db/auto-update is not 'true'.
Setting up cython3 (0.29.21-3+b1) ...
Setting up python3.9-dev (3.9.1-1+rpi1) ...
Setting up cmake (3.18.4-1+rpi1+b1) ...
Setting up python3-lib2to3 (3.9.1-2) ...
Setting up python3-pkg-resources (51.1.0-1) ...
Setting up python3-distutils (3.9.1-2) ...
Setting up dh-python (4.20201102) ...
Setting up libpython3-dev:armhf (3.9.1-1) ...
Setting up python3-setuptools (51.1.0-1) ...
Setting up python3-all (3.9.1-1) ...
Setting up libpython3-all-dev:armhf (3.9.1-1) ...
Setting up python3-dev (3.9.1-1) ...
Setting up python3-all-dev (3.9.1-1) ...
Setting up dh-autoreconf (19) ...
Setting up debhelper (13.3.1) ...
Setting up sbuild-build-depends-main-dummy (0.invalid.0) ...
Processing triggers for libc-bin (2.31-6+rpi1) ...
+------------------------------------------------------------------------------+
| Check architectures |
+------------------------------------------------------------------------------+
Arch check ok (armhf included in any)
+------------------------------------------------------------------------------+
| Build environment |
+------------------------------------------------------------------------------+
Kernel: Linux 4.19.20-v7+ #1 SMP Mon Mar 18 11:37:02 GMT 2019 armhf (armv7l)
Toolchain package versions: binutils_2.35.1-6+rpi1 dpkg-dev_1.20.5+rpi1 g++-10_10.2.1-1+rpi1 gcc-10_10.2.1-1+rpi1 libc6-dev_2.31-6+rpi1 libstdc++-10-dev_10.2.1-1+rpi1 libstdc++6_10.2.1-1+rpi1 linux-libc-dev_5.9.6-1+rpi1+b1
Package versions: adduser_3.118 apt_2.1.12+deb11u1 autoconf_2.69-14 automake_1:1.16.3-2 autopoint_0.21-3 autotools-dev_20180224.1+nmu1 base-files_11+rpi1 base-passwd_3.5.48 bash_5.1-1 binutils_2.35.1-6+rpi1 binutils-arm-linux-gnueabihf_2.35.1-6+rpi1 binutils-common_2.35.1-6+rpi1 bsdextrautils_2.36.1-4 bsdutils_1:2.36.1-3 build-essential_12.8 bzip2_1.0.8-4 cmake_3.18.4-1+rpi1+b1 cmake-data_3.18.4-1+rpi1 coreutils_8.32-4 cpp_4:10.2.0-1+rpi1 cpp-10_10.2.1-1+rpi1 cython3_0.29.21-3+b1 d-shlibs_0.98 dash_0.5.11+git20200708+dd9ef66-5 debconf_1.5.74 debhelper_13.3.1 debianutils_4.11.2 dh-autoreconf_19 dh-python_4.20201102 dh-strip-nondeterminism_1.9.0-1 diffutils_1:3.7-3 dirmngr_2.2.20-1 dpkg_1.20.5+rpi1 dpkg-dev_1.20.5+rpi1 dwz_0.13+20201015-2 e2fsprogs_1.45.6-1 fakeroot_1.25.3-1.1 file_1:5.39-3 findutils_4.7.0+git20201010-2 g++_4:10.2.0-1+rpi1 g++-10_10.2.1-1+rpi1 gcc_4:10.2.0-1+rpi1 gcc-10_10.2.1-1+rpi1 gcc-10-base_10.2.1-1+rpi1 gcc-7-base_7.5.0-6+rpi1+b2 gcc-8-base_8.4.0-5+rpi1 gcc-9-base_9.3.0-19+rpi1 gettext_0.21-3 gettext-base_0.21-3 gnupg_2.2.20-1 gnupg-l10n_2.2.20-1 gnupg-utils_2.2.20-1 gpg_2.2.20-1 gpg-agent_2.2.20-1 gpg-wks-client_2.2.20-1 gpg-wks-server_2.2.20-1 gpgconf_2.2.20-1 gpgsm_2.2.20-1 gpgv_2.2.20-1 grep_3.6-1 groff-base_1.22.4-5 gzip_1.10-2 hostname_3.23 init-system-helpers_1.60 intltool-debian_0.35.0+20060710.5 libacl1_2.2.53-9 libapt-pkg6.0_2.1.12+deb11u1 libarchive-zip-perl_1.68-1 libarchive13_3.4.3-2 libasan6_10.2.1-1+rpi1 libassuan0_2.5.3-7.1 libatomic1_10.2.1-1+rpi1 libattr1_1:2.4.48-6 libaudit-common_1:3.0-1 libaudit1_1:3.0-1 libbinutils_2.35.1-6+rpi1 libblkid1_2.36.1-3 libbrotli1_1.0.9-2+b1 libbz2-1.0_1.0.8-4 libc-bin_2.31-6+rpi1 libc-dev-bin_2.31-6+rpi1 libc6_2.31-6+rpi1 libc6-dev_2.31-6+rpi1 libcap-ng0_0.7.9-2.2+b1 libcc1-0_10.2.1-1+rpi1 libcom-err2_1.45.6-1 libcrypt-dev_1:4.4.17-1 libcrypt1_1:4.4.17-1 libctf-nobfd0_2.35.1-6+rpi1 libctf0_2.35.1-6+rpi1 libcurl4_7.74.0-1 libdb5.3_5.3.28+dfsg1-0.6 libdebconfclient0_0.255+b1 libdebhelper-perl_13.3.1 libdpkg-perl_1.20.5+rpi1 libelf1_0.182-3 libexpat1_2.2.10-1 libexpat1-dev_2.2.10-1 libext2fs2_1.45.6-1 libfakeroot_1.25.3-1.1 libffi7_3.3-5 libfile-stripnondeterminism-perl_1.9.0-1 libgcc-10-dev_10.2.1-1+rpi1 libgcc-s1_10.2.1-1+rpi1 libgcrypt20_1.8.7-2 libgdbm-compat4_1.18.1-5.1 libgdbm6_1.18.1-5.1 libgmp10_2:6.2.1+dfsg-1 libgnutls30_3.6.15-4 libgomp1_10.2.1-1+rpi1 libgpg-error0_1.38-2 libgssapi-krb5-2_1.18.3-4 libhogweed6_3.6-2 libicu67_67.1-5 libidn2-0_2.3.0-4 libisl23_0.23-1 libjsoncpp24_1.9.4-4 libk5crypto3_1.18.3-4 libkeyutils1_1.6.1-2 libkrb5-3_1.18.3-4 libkrb5support0_1.18.3-4 libksba8_1.5.0-3 libldap-2.4-2_2.4.56+dfsg-1+rpi1+b1 liblocale-gettext-perl_1.07-4+b1 liblz4-1_1.9.3-1+rpi1 liblzma5_5.2.4-1 libmagic-mgc_1:5.39-3 libmagic1_1:5.39-3 libmount1_2.36.1-3 libmpc3_1.2.0-1 libmpfr6_4.1.0-3 libncurses6_6.2+20201114-2 libncursesw6_6.2+20201114-2 libnettle8_3.6-2 libnghttp2-14_1.42.0-1 libnpth0_1.6-3 libnsl-dev_1.3.0-2 libnsl2_1.3.0-2 libnss-nis_3.1-4 libnss-nisplus_1.3-4 libp11-kit0_0.23.22-1 libpam-modules_1.3.1-5 libpam-modules-bin_1.3.1-5 libpam-runtime_1.3.1-5 libpam0g_1.3.1-5 libpcre2-8-0_10.36-2 libpcre3_2:8.39-13 libperl5.32_5.32.0-6 libpipeline1_1.5.3-1 libprocps8_2:3.3.16-5 libpsl5_0.21.0-1.1 libpython3-all-dev_3.9.1-1 libpython3-dev_3.9.1-1 libpython3-stdlib_3.9.1-1 libpython3.9_3.9.1-1+rpi1 libpython3.9-dev_3.9.1-1+rpi1 libpython3.9-minimal_3.9.1-1+rpi1 libpython3.9-stdlib_3.9.1-1+rpi1 libreadline8_8.1-1 librhash0_1.4.1-1 librtmp1_2.4+20151223.gitfa8646d.1-2+b2 libsasl2-2_2.1.27+dfsg-2 libsasl2-modules-db_2.1.27+dfsg-2 libseccomp2_2.5.1-1+rpi1 libselinux1_3.1-2+b1 libsemanage-common_3.1-1 libsemanage1_3.1-1+b1 libsepol1_3.1-1 libsigsegv2_2.12-3 libsmartcols1_2.36.1-3 libsqlite3-0_3.34.0-1 libss2_1.45.6-1 libssh2-1_1.9.0-2 libssl1.1_1.1.1i-1 libstdc++-10-dev_10.2.1-1+rpi1 libstdc++6_10.2.1-1+rpi1 libsub-override-perl_0.09-2 libsystemd0_246.6-4+rpi1 libtasn1-6_4.16.0-2 libtext-iconv-perl_1.7-7+b1 libtinfo6_6.2+20201114-2 libtirpc-common_1.2.6-3 libtirpc-dev_1.2.6-3 libtirpc3_1.2.6-3 libtool_2.4.6-15 libubsan1_10.2.1-1+rpi1 libuchardet0_0.0.7-1 libudev1_246.6-4+rpi1 libunistring2_0.9.10-4 libuuid1_2.36.1-3 libuv1_1.40.0-1 libxml2_2.9.10+dfsg-6.3 libzstd1_1.4.5+dfsg-4+rpi1 linux-libc-dev_5.9.6-1+rpi1+b1 login_1:4.8.1-1 logsave_1.45.6-1 lsb-base_11.1.0+rpi1 m4_1.4.18-5 mailcap_3.68 make_4.3-4 man-db_2.9.3-2 mawk_1.3.4.20200120-2 media-types_1.1.0 mime-support_3.66 mount_2.36.1-3 ncurses-base_6.2+20201114-1 ncurses-bin_6.2+20201114-1 passwd_1:4.8.1-1 patch_2.7.6-6 perl_5.32.0-6 perl-base_5.32.0-6 perl-modules-5.32_5.32.0-6 pinentry-curses_1.1.0-4 po-debconf_1.0.21+nmu1 procps_2:3.3.16-5 python3_3.9.1-1 python3-all_3.9.1-1 python3-all-dev_3.9.1-1 python3-dev_3.9.1-1 python3-distutils_3.9.1-2 python3-lib2to3_3.9.1-2 python3-minimal_3.9.1-1 python3-pkg-resources_51.1.0-1 python3-setuptools_51.1.0-1 python3.9_3.9.1-1+rpi1 python3.9-dev_3.9.1-1+rpi1 python3.9-minimal_3.9.1-1+rpi1 raspbian-archive-keyring_20120528.2 readline-common_8.1-1 rename_1.13-1 sbuild-build-depends-main-dummy_0.invalid.0 sed_4.7-1 sensible-utils_0.0.14 sysvinit-utils_2.96-5 tar_1.32+dfsg-1+rpi1 tzdata_2020e-1 util-linux_2.36.1-3 xz-utils_5.2.4-1 zlib1g_1:1.2.11.dfsg-2 zlib1g-dev_1:1.2.11.dfsg-2
+------------------------------------------------------------------------------+
| Build |
+------------------------------------------------------------------------------+
Unpack source
-------------
-----BEGIN PGP SIGNED MESSAGE-----
Hash: SHA256
Format: 3.0 (quilt)
Source: libedlib
Binary: libedlib0, libedlib-dev, edlib-aligner, python3-edlib
Architecture: any
Version: 1.2.6-1
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Uploaders: Andreas Tille <tille@debian.org>
Homepage: https://github.com/Martinsos/edlib
Standards-Version: 4.5.1
Vcs-Browser: https://salsa.debian.org/med-team/libedlib
Vcs-Git: https://salsa.debian.org/med-team/libedlib.git
Testsuite: autopkgtest
Build-Depends: debhelper-compat (= 12), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools
Package-List:
edlib-aligner deb science optional arch=any
libedlib-dev deb libdevel optional arch=any
libedlib0 deb libs optional arch=any
python3-edlib deb python optional arch=any
Checksums-Sha1:
a1e9aa839ff866647cfaacd9cfb729b4d5ef79ec 4311571 libedlib_1.2.6.orig.tar.gz
33c8b6069f9ee69e2fc020ebf778440d85a3e787 6596 libedlib_1.2.6-1.debian.tar.xz
Checksums-Sha256:
0436f14b0339dabd2aab7faf3779ac1b4bbbdc46246c1bff49be997fe4b4e2c7 4311571 libedlib_1.2.6.orig.tar.gz
178cf652b5a617ee06b5ac46f02201844ffaf4d63a111c43b73ac681ee9ffaf6 6596 libedlib_1.2.6-1.debian.tar.xz
Files:
86666eb3b10c30ea291289f753629d12 4311571 libedlib_1.2.6.orig.tar.gz
0c1503ba653517eb4c40e809b620e597 6596 libedlib_1.2.6-1.debian.tar.xz
-----BEGIN PGP SIGNATURE-----
iQJFBAEBCAAvFiEE8fAHMgoDVUHwpmPKV4oElNHGRtEFAl/90w8RHHRpbGxlQGRl
Ymlhbi5vcmcACgkQV4oElNHGRtExEBAAkKo3XSTnyz0fzwu8AL0ts/Su0HkPRvNA
oAywxAIEcuOPETwz6Kw3iIwPOy5aKTxpCu8EjaoypYXUl7uNf/zTySjyAqqac+zi
mIl2TRo2hFHx9u/VmUxa1pPlvayjo8epmYAy9fOaokx5I9fpbbFPwEMCdRXloZHj
xvs6JIUEwrMisJbvt3RogkqlSVmrs1MrJdMWTIgZlZ3dc6yFe0KmRkqXdd/bCP60
bbRUuIvpJ0YnBMjr0kQ5O+UHTGTfukt3X0KtBCZy1l/6gELIaCmIveIanff2pZAf
h+/FPHVndR/7vyMFhkFrDfQFOzUBH4UP/xy4yyPYo5Sp25B7cQlN6roKg8BlaOPP
clGAGD0IEIVLpyEI3ThpJARJaI2hm/naGGSTozR3GZUe6qgsDfxI+CwwDTo6W9z9
cCHkRQ8bMzjsGdQ/0yXQXUcF7LbB3/GNJCWoupnchjdThBTuPWsYf4HkR1Fkb8v1
9E7znynr/L9mEBhfXn7v6y9R8HEc8ysjqnuZw1te4d29a+JBzoejpTyajNEC5F5P
boqXo2w3nPHd97gUrcD+CXC17fJS9+nRwLZihSPMJYsfWBedNSd7vFJ8LcJ8luOr
NYje45zYtBlnR79IIA6adbNELg4IZmtmJRFGePerR04wj5uMzrUdk0c29QQg2BGq
oGnDLHWpzjk=
=pDZ2
-----END PGP SIGNATURE-----
gpgv: unknown type of key resource 'trustedkeys.kbx'
gpgv: keyblock resource '/tmp/dpkg-verify-sig.k3gQaAuk/trustedkeys.kbx': General error
gpgv: Signature made Tue Jan 12 16:49:19 2021 UTC
gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1
gpgv: issuer "tille@debian.org"
gpgv: Can't check signature: No public key
dpkg-source: warning: failed to verify signature on ./libedlib_1.2.6-1.dsc
dpkg-source: info: extracting libedlib in /<<PKGBUILDDIR>>
dpkg-source: info: unpacking libedlib_1.2.6.orig.tar.gz
dpkg-source: info: unpacking libedlib_1.2.6-1.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying soversion.patch
dpkg-source: info: applying do_not_build_hello_example.patch
dpkg-source: info: applying cython3.patch
dpkg-source: info: applying enable_shared_and_static.patch
Check disk space
----------------
Sufficient free space for build
User Environment
----------------
APT_CONFIG=/var/lib/sbuild/apt.conf
DBUS_SESSION_BUS_ADDRESS=unix:path=/run/user/112/bus
DEB_BUILD_OPTIONS=parallel=4
HOME=/sbuild-nonexistent
LC_ALL=C.UTF-8
LOGNAME=buildd
PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games
PWD=/build/buildd
SCHROOT_ALIAS_NAME=bullseye-staging-armhf-sbuild
SCHROOT_CHROOT_NAME=bullseye-staging-armhf-sbuild
SCHROOT_COMMAND=env
SCHROOT_GID=117
SCHROOT_GROUP=buildd
SCHROOT_SESSION_ID=bullseye-staging-armhf-sbuild-e71d495a-25ef-4340-a0ea-15b7014ed96e
SCHROOT_UID=112
SCHROOT_USER=buildd
SHELL=/bin/sh
USER=buildd
XDG_RUNTIME_DIR=/run/user/112
XDG_SESSION_CLASS=background
XDG_SESSION_ID=c32520
XDG_SESSION_TYPE=unspecified
dpkg-buildpackage
-----------------
Command: dpkg-buildpackage -us -uc -mRaspbian pi4 based autobuilder <root@raspbian.org> -B -rfakeroot
dpkg-buildpackage: info: source package libedlib
dpkg-buildpackage: info: source version 1.2.6-1
dpkg-buildpackage: info: source distribution unstable
dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
fakeroot debian/rules clean
dh clean --with python3
dh_clean
debian/rules build-arch
dh build-arch --with python3
dh_update_autotools_config -a
dh_autoreconf -a
debian/rules override_dh_auto_configure
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_configure --buildsystem=cmake -- -DCMAKE_BUILD_TYPE=Release
cd obj-arm-linux-gnueabihf && cmake -DCMAKE_INSTALL_PREFIX=/usr -DCMAKE_BUILD_TYPE=None -DCMAKE_INSTALL_SYSCONFDIR=/etc -DCMAKE_INSTALL_LOCALSTATEDIR=/var -DCMAKE_EXPORT_NO_PACKAGE_REGISTRY=ON -DCMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY=ON -DCMAKE_INSTALL_RUNSTATEDIR=/run "-GUnix Makefiles" -DCMAKE_VERBOSE_MAKEFILE=ON -DCMAKE_INSTALL_LIBDIR=lib/arm-linux-gnueabihf -DCMAKE_BUILD_TYPE=Release ..
-- The C compiler identification is GNU 10.2.1
-- The CXX compiler identification is GNU 10.2.1
-- Detecting C compiler ABI info
-- Detecting C compiler ABI info - done
-- Check for working C compiler: /usr/bin/cc - skipped
-- Detecting C compile features
-- Detecting C compile features - done
-- Detecting CXX compiler ABI info
-- Detecting CXX compiler ABI info - done
-- Check for working CXX compiler: /usr/bin/c++ - skipped
-- Detecting CXX compile features
-- Detecting CXX compile features - done
Setting warning flags
-- Performing Test WOLD_STYLE_CAST
-- Performing Test WOLD_STYLE_CAST - Success
-- Performing Test WSHADOW
-- Performing Test WSHADOW - Success
-- Configuring done
-- Generating done
CMake Warning:
Manually-specified variables were not used by the project:
CMAKE_EXPORT_NO_PACKAGE_REGISTRY
CMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY
-- Build files have been written to: /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_auto_build
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_build --buildsystem=cmake
cd obj-arm-linux-gnueabihf && make -j4 "INSTALL=install --strip-program=true" VERBOSE=1
make[2]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -S/<<PKGBUILDDIR>> -B/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf//CMakeFiles/progress.marks
make -f CMakeFiles/Makefile2 all
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake --color=
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake --color=
Dependee "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake" is newer than depender "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/depend.internal".
Dependee "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake" is newer than depender "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/depend.internal".
Dependee "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/depend.internal".
Dependee "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/depend.internal".
Scanning dependencies of target edlib
Scanning dependencies of target edlib_static
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 25%] Building CXX object CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o
[ 25%] Building CXX object CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o
/usr/bin/c++ -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -c /<<PKGBUILDDIR>>/edlib/src/edlib.cpp
/usr/bin/c++ -Dedlib_EXPORTS -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -fPIC -std=c++11 -o CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -c /<<PKGBUILDDIR>>/edlib/src/edlib.cpp
[ 37%] Linking CXX static library lib/libedlib_static.a
/usr/bin/cmake -P CMakeFiles/edlib_static.dir/cmake_clean_target.cmake
[ 50%] Linking CXX shared library lib/libedlib.so
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib.dir/link.txt --verbose=1
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib_static.dir/link.txt --verbose=1
/usr/bin/c++ -fPIC -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -shared -Wl,-soname,libedlib.so.0 -o lib/libedlib.so.1.2.5 CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o
/usr/bin/ar qc lib/libedlib_static.a CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o
/usr/bin/ranlib lib/libedlib_static.a
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 50%] Built target edlib_static
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color=
Dependee "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake" is newer than depender "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/depend.internal".
Dependee "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/depend.internal".
Scanning dependencies of target edlib-aligner
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 62%] Building CXX object CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o
/usr/bin/c++ -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -c /<<PKGBUILDDIR>>/apps/aligner/aligner.cpp
/usr/bin/cmake -E cmake_symlink_library lib/libedlib.so.1.2.5 lib/libedlib.so.0 lib/libedlib.so
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 62%] Built target edlib
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/DependInfo.cmake --color=
Dependee "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/DependInfo.cmake" is newer than depender "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/depend.internal".
Dependee "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/depend.internal".
Scanning dependencies of target runTests
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 75%] Building CXX object CMakeFiles/runTests.dir/test/runTests.cpp.o
/usr/bin/c++ -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/runTests.dir/test/runTests.cpp.o -c /<<PKGBUILDDIR>>/test/runTests.cpp
[ 87%] Linking CXX executable bin/edlib-aligner
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib-aligner.dir/link.txt --verbose=1
/usr/bin/c++ -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -o bin/edlib-aligner lib/libedlib_static.a
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 87%] Built target edlib-aligner
[100%] Linking CXX executable bin/runTests
/usr/bin/cmake -E cmake_link_script CMakeFiles/runTests.dir/link.txt --verbose=1
/usr/bin/c++ -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/runTests.dir/test/runTests.cpp.o -o bin/runTests -Wl,-rpath,/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/lib lib/libedlib.so.1.2.5
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[100%] Built target runTests
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles 0
make[2]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
# /usr/bin/make --directory=bindings/python
/usr/bin/make --directory=bindings/python edlib pyedlib.bycython.cpp
make[2]: Entering directory '/<<PKGBUILDDIR>>/bindings/python'
cp -R ../../edlib .
cython3 --cplus edlib.pyx -o edlib.bycython.cpp
/usr/lib/python3/dist-packages/Cython/Compiler/Main.py:369: FutureWarning: Cython directive 'language_level' not set, using 2 for now (Py2). This will change in a later release! File: /<<PKGBUILDDIR>>/bindings/python/edlib.pyx
tree = Parsing.p_module(s, pxd, full_module_name)
make[2]: Leaving directory '/<<PKGBUILDDIR>>/bindings/python'
dh_auto_build --buildsystem=pybuild -- --dir bindings/python
I: pybuild base:232: /usr/bin/python3 setup.py build
running build
running build_ext
building 'edlib' extension
creating build
creating build/temp.linux-armhf-3.9
creating build/temp.linux-armhf-3.9/edlib
creating build/temp.linux-armhf-3.9/edlib/src
arm-linux-gnueabihf-gcc -pthread -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.9 -c edlib.bycython.cpp -o build/temp.linux-armhf-3.9/edlib.bycython.o -O3 -std=c++11
arm-linux-gnueabihf-gcc -pthread -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.9 -c edlib/src/edlib.cpp -o build/temp.linux-armhf-3.9/edlib/src/edlib.o -O3 -std=c++11
arm-linux-gnueabihf-g++ -pthread -shared -Wl,-O1 -Wl,-Bsymbolic-functions -Wl,-z,relro -g -fwrapv -O2 -Wl,-z,relro -Wl,-z,now -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 build/temp.linux-armhf-3.9/edlib.bycython.o build/temp.linux-armhf-3.9/edlib/src/edlib.o -o /<<PKGBUILDDIR>>/.pybuild/cpython3_3.9_edlib/build/edlib.cpython-39-arm-linux-gnueabihf.so
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_auto_test
make[1]: Entering directory '/<<PKGBUILDDIR>>'
`find . -name edlib-aligner -type f -executable` -p apps/aligner/test_data/query.fasta apps/aligner/test_data/target.fasta
Using NW alignment mode.
Reading queries...
Read 1 queries, 110 residues total.
Reading target fasta file...
Read target, 109 residues.
Comparing queries to target...
Query #0 (110 residues): score = 17
T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48)
||||||| | |||||||||| |||||||||||||||||||||||||||
Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46)
T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92)
| |||||||||||| || |||||||||| ||||||||| |||||| |
Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94)
T: AESIKSKKKKKE-STTB (93 - 108)
||||||||||| |||
Q: -ESIKSKKKKKENSTT- (94 - 109)
Cpu time of searching: 0.000176
`find . -name runTests`
Testing HW with alignment...
HW: [32m100/100[0m random tests passed!
Time Edlib: 0.126144
Time Simple: 0.544372
Times faster: 4.32
Testing HW...
HW: [32m100/100[0m random tests passed!
Time Edlib: 0.110647
Time Simple: 0.577569
Times faster: 5.22
Testing NW with alignment...
NW: [32m100/100[0m random tests passed!
Time Edlib: 0.230227
Time Simple: 0.602273
Times faster: 2.62
Testing NW...
NW: [32m100/100[0m random tests passed!
Time Edlib: 0.051375
Time Simple: 0.495343
Times faster: 9.64
Testing SHW with alignment...
SHW: [32m100/100[0m random tests passed!
Time Edlib: 0.013693
Time Simple: 0.544334
Times faster: 39.75
Testing SHW...
SHW: [32m100/100[0m random tests passed!
Time Edlib: 0.008461
Time Simple: 0.526974
Times faster: 62.28
Specific tests:
Test #0:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #1:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #2:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #3:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #4:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #5:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #6:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #7:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #8:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #9:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #10:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #11:
[32mOK[0m
Test #12:
[32mOK[0m
Test #13:
[32mOK[0m
Test #14:
[32mOK[0m
Test #15:
[32mOK[0m
Test #16:
Cigar extended: [32mOK[0m
Cigar standard: [32mOK[0m
Test #17:
Degenerate nucleotides (HW): [32mOK[0m
Test #18:
Empty query or target:
NW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
SHW: [32m OK [0m
HW: [32m OK [0m
HW: [32m OK [0m
All specific tests passed!
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
create-stamp debian/debhelper-build-stamp
fakeroot debian/rules binary-arch
dh binary-arch --with python3
dh_testroot -a
dh_prep -a
debian/rules override_dh_auto_install
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_install --buildsystem=cmake
cd obj-arm-linux-gnueabihf && make -j4 install DESTDIR=/<<PKGBUILDDIR>>/debian/tmp AM_UPDATE_INFO_DIR=no "INSTALL=install --strip-program=true"
make[2]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -S/<<PKGBUILDDIR>> -B/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf//CMakeFiles/progress.marks
make -f CMakeFiles/Makefile2 all
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake --color=
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake --color=
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/edlib_static.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/edlib.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 50%] Built target edlib
[ 50%] Built target edlib_static
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color=
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/DependInfo.cmake --color=
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/edlib-aligner.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/runTests.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[100%] Built target runTests
[100%] Built target edlib-aligner
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles 0
make -f CMakeFiles/Makefile2 preinstall
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[3]: Nothing to be done for 'preinstall'.
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
Install the project...
/usr/bin/cmake -P cmake_install.cmake
-- Install configuration: "Release"
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.5
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.0
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib_static.a
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/include/edlib.h
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/pkgconfig/edlib-1.pc
make[2]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
dh_auto_install --buildsystem=pybuild -- --dir bindings/python
I: pybuild base:232: /usr/bin/python3 setup.py install --root /<<PKGBUILDDIR>>/debian/python3-edlib
running install
running build
running build_ext
running install_lib
creating /<<PKGBUILDDIR>>/debian/python3-edlib
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9/dist-packages
copying /<<PKGBUILDDIR>>/.pybuild/cpython3_3.9_edlib/build/edlib.cpython-39-arm-linux-gnueabihf.so -> /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9/dist-packages
running install_egg_info
running egg_info
creating edlib.egg-info
writing edlib.egg-info/PKG-INFO
writing dependency_links to edlib.egg-info/dependency_links.txt
writing top-level names to edlib.egg-info/top_level.txt
writing manifest file 'edlib.egg-info/SOURCES.txt'
reading manifest file 'edlib.egg-info/SOURCES.txt'
reading manifest template 'MANIFEST.in'
writing manifest file 'edlib.egg-info/SOURCES.txt'
Copying edlib.egg-info to /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9/dist-packages/edlib-1.3.6.egg-info
Skipping SOURCES.txt
running install_scripts
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_install
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_install
file-rename 's/_static\.a/.a/' `find debian -name libedlib_static.a`
d-shlibmove --commit \
--multiarch \
--devunversioned \
--exclude-la \
--movedev debian/tmp/usr/include/* usr/include \
--movedev debian/tmp/usr/lib/*/pkgconfig usr/lib/arm-linux-gnueabihf \
debian/tmp/usr/lib/*/*.so
Library package automatic movement utility
set -e
install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
install -d -m 755 debian/libedlib0/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.a debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.0 debian/libedlib0/usr/lib/arm-linux-gnueabihf
mv /<<PKGBUILDDIR>>/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.5 debian/libedlib0/usr/lib/arm-linux-gnueabihf
PKGDEV=libedlib-dev
PKGSHL=libedlib0
install -d -m 755 debian/libedlib-dev/usr/include
mv debian/tmp/usr/include/edlib.h debian/libedlib-dev/usr/include
install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/arm-linux-gnueabihf/pkgconfig debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
dh_installdocs -a
dh_installchangelogs -a
dh_installexamples -a
dh_installman -a
dh_python3 -a
dh_perl -a
dh_link -a
dh_strip_nondeterminism -a
dh_compress -a
dh_fixperms -a
dh_missing -a
dh_dwz -a
dh_strip -a
dh_makeshlibs -a
dh_shlibdeps -a
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/edlib-aligner/usr/bin/edlib-aligner was not linked against ld-linux-armhf.so.3 (it uses none of the library's symbols)
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/python3-edlib/usr/lib/python3/dist-packages/edlib.cpython-39-arm-linux-gnueabihf.so was not linked against libpthread.so.0 (it uses none of the library's symbols)
dh_installdeb -a
dh_gencontrol -a
dpkg-gencontrol: warning: Depends field of package libedlib-dev: substitution variable ${shlibs:Depends} used, but is not defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined
dh_md5sums -a
dh_builddeb -a
dpkg-deb: building package 'libedlib0' in '../libedlib0_1.2.6-1_armhf.deb'.
dpkg-deb: building package 'libedlib-dev' in '../libedlib-dev_1.2.6-1_armhf.deb'.
dpkg-deb: building package 'edlib-aligner-dbgsym' in '../edlib-aligner-dbgsym_1.2.6-1_armhf.deb'.
dpkg-deb: building package 'python3-edlib-dbgsym' in '../python3-edlib-dbgsym_1.2.6-1_armhf.deb'.
dpkg-deb: building package 'libedlib0-dbgsym' in '../libedlib0-dbgsym_1.2.6-1_armhf.deb'.
dpkg-deb: building package 'python3-edlib' in '../python3-edlib_1.2.6-1_armhf.deb'.
dpkg-deb: building package 'edlib-aligner' in '../edlib-aligner_1.2.6-1_armhf.deb'.
dpkg-genbuildinfo --build=any
dpkg-genchanges --build=any -mRaspbian pi4 based autobuilder <root@raspbian.org> >../libedlib_1.2.6-1_armhf.changes
dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included)
dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
--------------------------------------------------------------------------------
Build finished at 2021-01-15T12:41:11Z
Finished
--------
I: Built successfully
+------------------------------------------------------------------------------+
| Changes |
+------------------------------------------------------------------------------+
libedlib_1.2.6-1_armhf.changes:
-------------------------------
Format: 1.8
Date: Tue, 12 Jan 2021 16:33:05 +0100
Source: libedlib
Binary: edlib-aligner edlib-aligner-dbgsym libedlib-dev libedlib0 libedlib0-dbgsym python3-edlib python3-edlib-dbgsym
Architecture: armhf
Version: 1.2.6-1
Distribution: bullseye-staging
Urgency: medium
Maintainer: Raspbian pi4 based autobuilder <root@raspbian.org>
Changed-By: Andreas Tille <tille@debian.org>
Description:
edlib-aligner - edlib sequence alignment tool using edit distance
libedlib-dev - library for sequence alignment using edit distance (devel)
libedlib0 - library for sequence alignment using edit distance
python3-edlib - library for sequence alignment using edit distance (Python3 modul
Changes:
libedlib (1.2.6-1) unstable; urgency=medium
.
[ Andreas Tille ]
* New upstream version
* Standards-Version: 4.5.1 (routine-update)
.
[ Steffen Moeller ]
* Added refs to conda and omictools
.
[ Nilesh Patra ]
* Refresh patch
* Enable building both shared and static lib
* Modify d-shlibs for pkgconfig and gnuinstalldirs
* Rename lib package as per package version
Checksums-Sha1:
50d808e5b9c39e994572c3492d49e1b88c2a6e46 116744 edlib-aligner-dbgsym_1.2.6-1_armhf.deb
e83bfe9be6a52b4a3d0ffb5a18abb499162ca7f6 19308 edlib-aligner_1.2.6-1_armhf.deb
449a0c4ab188d804acf1a289aa0843b5f1636a7d 15904 libedlib-dev_1.2.6-1_armhf.deb
a1bb1f285888b3122e8d798dec5f6b69252d4b68 74348 libedlib0-dbgsym_1.2.6-1_armhf.deb
a8135f909709d45fb5f3770d01715b7a86b634ec 13644 libedlib0_1.2.6-1_armhf.deb
211e878f3ffa634e7dbce63b805d677d210874da 8547 libedlib_1.2.6-1_armhf.buildinfo
52c0e8710b162e30657bd8a6b9d9f69a13e5822b 269140 python3-edlib-dbgsym_1.2.6-1_armhf.deb
5750cc530053c70fadc1bac1d681d95721b4f810 51244 python3-edlib_1.2.6-1_armhf.deb
Checksums-Sha256:
8f5b92ba0100a26624e97f0d8f10ccbe6c7a91efa44bfe9ed04cf9d4efae1ff9 116744 edlib-aligner-dbgsym_1.2.6-1_armhf.deb
6def15ded0fa5a80d94bf9eadc191f3aa33456cfd44352bfb856700a485ac5b9 19308 edlib-aligner_1.2.6-1_armhf.deb
e9fa9e38c258f0e57b5387aa729ad7eade3fd9320ff8735f05e0d032c419a950 15904 libedlib-dev_1.2.6-1_armhf.deb
ba0492545e2e063f7408963cc5084c3d2a783c77902dd305beb0dec70c67b652 74348 libedlib0-dbgsym_1.2.6-1_armhf.deb
d29d1ac70f526c1b54fd55fa07481b72145efd6e7ca6aca362a12a0fa75c6cc9 13644 libedlib0_1.2.6-1_armhf.deb
101025d6afed2bc83b8f93b1dec16e3fe4161168816b708ab21960bff760efe4 8547 libedlib_1.2.6-1_armhf.buildinfo
29267337b0e25127d6fb0e9e81e603f6772ad2d258c0e6dda4134f7391247526 269140 python3-edlib-dbgsym_1.2.6-1_armhf.deb
19b2cc24eb545a5c7a0b4d88aed02245ac3720b2d6f001b154c3e41618f03717 51244 python3-edlib_1.2.6-1_armhf.deb
Files:
d67180e5f77f7b57bdcd0ce81987fc59 116744 debug optional edlib-aligner-dbgsym_1.2.6-1_armhf.deb
c7b598b6ef1d56d8172655ab9e24e6cc 19308 science optional edlib-aligner_1.2.6-1_armhf.deb
ec62fec66df421d282a15ba5a0c55f62 15904 libdevel optional libedlib-dev_1.2.6-1_armhf.deb
2eebd2f10c152be1fac53a88b76342fa 74348 debug optional libedlib0-dbgsym_1.2.6-1_armhf.deb
ad3543645abf760154b3942861813575 13644 libs optional libedlib0_1.2.6-1_armhf.deb
f90df8800a0c30186846a0a1d3e8dbec 8547 science optional libedlib_1.2.6-1_armhf.buildinfo
be122a2905c3b805509857227cb25e65 269140 debug optional python3-edlib-dbgsym_1.2.6-1_armhf.deb
249a389a37f1bf3adcb82c14cedd558a 51244 python optional python3-edlib_1.2.6-1_armhf.deb
+------------------------------------------------------------------------------+
| Buildinfo |
+------------------------------------------------------------------------------+
Format: 1.0
Source: libedlib
Binary: edlib-aligner edlib-aligner-dbgsym libedlib-dev libedlib0 libedlib0-dbgsym python3-edlib python3-edlib-dbgsym
Architecture: armhf
Version: 1.2.6-1
Checksums-Md5:
d67180e5f77f7b57bdcd0ce81987fc59 116744 edlib-aligner-dbgsym_1.2.6-1_armhf.deb
c7b598b6ef1d56d8172655ab9e24e6cc 19308 edlib-aligner_1.2.6-1_armhf.deb
ec62fec66df421d282a15ba5a0c55f62 15904 libedlib-dev_1.2.6-1_armhf.deb
2eebd2f10c152be1fac53a88b76342fa 74348 libedlib0-dbgsym_1.2.6-1_armhf.deb
ad3543645abf760154b3942861813575 13644 libedlib0_1.2.6-1_armhf.deb
be122a2905c3b805509857227cb25e65 269140 python3-edlib-dbgsym_1.2.6-1_armhf.deb
249a389a37f1bf3adcb82c14cedd558a 51244 python3-edlib_1.2.6-1_armhf.deb
Checksums-Sha1:
50d808e5b9c39e994572c3492d49e1b88c2a6e46 116744 edlib-aligner-dbgsym_1.2.6-1_armhf.deb
e83bfe9be6a52b4a3d0ffb5a18abb499162ca7f6 19308 edlib-aligner_1.2.6-1_armhf.deb
449a0c4ab188d804acf1a289aa0843b5f1636a7d 15904 libedlib-dev_1.2.6-1_armhf.deb
a1bb1f285888b3122e8d798dec5f6b69252d4b68 74348 libedlib0-dbgsym_1.2.6-1_armhf.deb
a8135f909709d45fb5f3770d01715b7a86b634ec 13644 libedlib0_1.2.6-1_armhf.deb
52c0e8710b162e30657bd8a6b9d9f69a13e5822b 269140 python3-edlib-dbgsym_1.2.6-1_armhf.deb
5750cc530053c70fadc1bac1d681d95721b4f810 51244 python3-edlib_1.2.6-1_armhf.deb
Checksums-Sha256:
8f5b92ba0100a26624e97f0d8f10ccbe6c7a91efa44bfe9ed04cf9d4efae1ff9 116744 edlib-aligner-dbgsym_1.2.6-1_armhf.deb
6def15ded0fa5a80d94bf9eadc191f3aa33456cfd44352bfb856700a485ac5b9 19308 edlib-aligner_1.2.6-1_armhf.deb
e9fa9e38c258f0e57b5387aa729ad7eade3fd9320ff8735f05e0d032c419a950 15904 libedlib-dev_1.2.6-1_armhf.deb
ba0492545e2e063f7408963cc5084c3d2a783c77902dd305beb0dec70c67b652 74348 libedlib0-dbgsym_1.2.6-1_armhf.deb
d29d1ac70f526c1b54fd55fa07481b72145efd6e7ca6aca362a12a0fa75c6cc9 13644 libedlib0_1.2.6-1_armhf.deb
29267337b0e25127d6fb0e9e81e603f6772ad2d258c0e6dda4134f7391247526 269140 python3-edlib-dbgsym_1.2.6-1_armhf.deb
19b2cc24eb545a5c7a0b4d88aed02245ac3720b2d6f001b154c3e41618f03717 51244 python3-edlib_1.2.6-1_armhf.deb
Build-Origin: Raspbian
Build-Architecture: armhf
Build-Date: Fri, 15 Jan 2021 12:41:10 +0000
Build-Path: /<<PKGBUILDDIR>>
Installed-Build-Depends:
adduser (= 3.118),
apt (= 2.1.12+deb11u1),
autoconf (= 2.69-14),
automake (= 1:1.16.3-2),
autopoint (= 0.21-3),
autotools-dev (= 20180224.1+nmu1),
base-files (= 11+rpi1),
base-passwd (= 3.5.48),
bash (= 5.1-1),
binutils (= 2.35.1-6+rpi1),
binutils-arm-linux-gnueabihf (= 2.35.1-6+rpi1),
binutils-common (= 2.35.1-6+rpi1),
bsdextrautils (= 2.36.1-4),
bsdutils (= 1:2.36.1-3),
build-essential (= 12.8),
bzip2 (= 1.0.8-4),
cmake (= 3.18.4-1+rpi1+b1),
cmake-data (= 3.18.4-1+rpi1),
coreutils (= 8.32-4),
cpp (= 4:10.2.0-1+rpi1),
cpp-10 (= 10.2.1-1+rpi1),
cython3 (= 0.29.21-3+b1),
d-shlibs (= 0.98),
dash (= 0.5.11+git20200708+dd9ef66-5),
debconf (= 1.5.74),
debhelper (= 13.3.1),
debianutils (= 4.11.2),
dh-autoreconf (= 19),
dh-python (= 4.20201102),
dh-strip-nondeterminism (= 1.9.0-1),
diffutils (= 1:3.7-3),
dirmngr (= 2.2.20-1),
dpkg (= 1.20.5+rpi1),
dpkg-dev (= 1.20.5+rpi1),
dwz (= 0.13+20201015-2),
file (= 1:5.39-3),
findutils (= 4.7.0+git20201010-2),
g++ (= 4:10.2.0-1+rpi1),
g++-10 (= 10.2.1-1+rpi1),
gcc (= 4:10.2.0-1+rpi1),
gcc-10 (= 10.2.1-1+rpi1),
gcc-10-base (= 10.2.1-1+rpi1),
gettext (= 0.21-3),
gettext-base (= 0.21-3),
gnupg (= 2.2.20-1),
gnupg-l10n (= 2.2.20-1),
gnupg-utils (= 2.2.20-1),
gpg (= 2.2.20-1),
gpg-agent (= 2.2.20-1),
gpg-wks-client (= 2.2.20-1),
gpg-wks-server (= 2.2.20-1),
gpgconf (= 2.2.20-1),
gpgsm (= 2.2.20-1),
gpgv (= 2.2.20-1),
grep (= 3.6-1),
groff-base (= 1.22.4-5),
gzip (= 1.10-2),
hostname (= 3.23),
init-system-helpers (= 1.60),
intltool-debian (= 0.35.0+20060710.5),
libacl1 (= 2.2.53-9),
libapt-pkg6.0 (= 2.1.12+deb11u1),
libarchive-zip-perl (= 1.68-1),
libarchive13 (= 3.4.3-2),
libasan6 (= 10.2.1-1+rpi1),
libassuan0 (= 2.5.3-7.1),
libatomic1 (= 10.2.1-1+rpi1),
libattr1 (= 1:2.4.48-6),
libaudit-common (= 1:3.0-1),
libaudit1 (= 1:3.0-1),
libbinutils (= 2.35.1-6+rpi1),
libblkid1 (= 2.36.1-3),
libbrotli1 (= 1.0.9-2+b1),
libbz2-1.0 (= 1.0.8-4),
libc-bin (= 2.31-6+rpi1),
libc-dev-bin (= 2.31-6+rpi1),
libc6 (= 2.31-6+rpi1),
libc6-dev (= 2.31-6+rpi1),
libcap-ng0 (= 0.7.9-2.2+b1),
libcc1-0 (= 10.2.1-1+rpi1),
libcom-err2 (= 1.45.6-1),
libcrypt-dev (= 1:4.4.17-1),
libcrypt1 (= 1:4.4.17-1),
libctf-nobfd0 (= 2.35.1-6+rpi1),
libctf0 (= 2.35.1-6+rpi1),
libcurl4 (= 7.74.0-1),
libdb5.3 (= 5.3.28+dfsg1-0.6),
libdebconfclient0 (= 0.255+b1),
libdebhelper-perl (= 13.3.1),
libdpkg-perl (= 1.20.5+rpi1),
libelf1 (= 0.182-3),
libexpat1 (= 2.2.10-1),
libexpat1-dev (= 2.2.10-1),
libffi7 (= 3.3-5),
libfile-stripnondeterminism-perl (= 1.9.0-1),
libgcc-10-dev (= 10.2.1-1+rpi1),
libgcc-s1 (= 10.2.1-1+rpi1),
libgcrypt20 (= 1.8.7-2),
libgdbm-compat4 (= 1.18.1-5.1),
libgdbm6 (= 1.18.1-5.1),
libgmp10 (= 2:6.2.1+dfsg-1),
libgnutls30 (= 3.6.15-4),
libgomp1 (= 10.2.1-1+rpi1),
libgpg-error0 (= 1.38-2),
libgssapi-krb5-2 (= 1.18.3-4),
libhogweed6 (= 3.6-2),
libicu67 (= 67.1-5),
libidn2-0 (= 2.3.0-4),
libisl23 (= 0.23-1),
libjsoncpp24 (= 1.9.4-4),
libk5crypto3 (= 1.18.3-4),
libkeyutils1 (= 1.6.1-2),
libkrb5-3 (= 1.18.3-4),
libkrb5support0 (= 1.18.3-4),
libksba8 (= 1.5.0-3),
libldap-2.4-2 (= 2.4.56+dfsg-1+rpi1+b1),
liblz4-1 (= 1.9.3-1+rpi1),
liblzma5 (= 5.2.4-1),
libmagic-mgc (= 1:5.39-3),
libmagic1 (= 1:5.39-3),
libmount1 (= 2.36.1-3),
libmpc3 (= 1.2.0-1),
libmpfr6 (= 4.1.0-3),
libncurses6 (= 6.2+20201114-2),
libncursesw6 (= 6.2+20201114-2),
libnettle8 (= 3.6-2),
libnghttp2-14 (= 1.42.0-1),
libnpth0 (= 1.6-3),
libnsl-dev (= 1.3.0-2),
libnsl2 (= 1.3.0-2),
libp11-kit0 (= 0.23.22-1),
libpam-modules (= 1.3.1-5),
libpam-modules-bin (= 1.3.1-5),
libpam-runtime (= 1.3.1-5),
libpam0g (= 1.3.1-5),
libpcre2-8-0 (= 10.36-2),
libpcre3 (= 2:8.39-13),
libperl5.32 (= 5.32.0-6),
libpipeline1 (= 1.5.3-1),
libprocps8 (= 2:3.3.16-5),
libpsl5 (= 0.21.0-1.1),
libpython3-all-dev (= 3.9.1-1),
libpython3-dev (= 3.9.1-1),
libpython3-stdlib (= 3.9.1-1),
libpython3.9 (= 3.9.1-1+rpi1),
libpython3.9-dev (= 3.9.1-1+rpi1),
libpython3.9-minimal (= 3.9.1-1+rpi1),
libpython3.9-stdlib (= 3.9.1-1+rpi1),
libreadline8 (= 8.1-1),
librhash0 (= 1.4.1-1),
librtmp1 (= 2.4+20151223.gitfa8646d.1-2+b2),
libsasl2-2 (= 2.1.27+dfsg-2),
libsasl2-modules-db (= 2.1.27+dfsg-2),
libseccomp2 (= 2.5.1-1+rpi1),
libselinux1 (= 3.1-2+b1),
libsemanage-common (= 3.1-1),
libsemanage1 (= 3.1-1+b1),
libsepol1 (= 3.1-1),
libsigsegv2 (= 2.12-3),
libsmartcols1 (= 2.36.1-3),
libsqlite3-0 (= 3.34.0-1),
libssh2-1 (= 1.9.0-2),
libssl1.1 (= 1.1.1i-1),
libstdc++-10-dev (= 10.2.1-1+rpi1),
libstdc++6 (= 10.2.1-1+rpi1),
libsub-override-perl (= 0.09-2),
libsystemd0 (= 246.6-4+rpi1),
libtasn1-6 (= 4.16.0-2),
libtinfo6 (= 6.2+20201114-2),
libtirpc-common (= 1.2.6-3),
libtirpc-dev (= 1.2.6-3),
libtirpc3 (= 1.2.6-3),
libtool (= 2.4.6-15),
libubsan1 (= 10.2.1-1+rpi1),
libuchardet0 (= 0.0.7-1),
libudev1 (= 246.6-4+rpi1),
libunistring2 (= 0.9.10-4),
libuuid1 (= 2.36.1-3),
libuv1 (= 1.40.0-1),
libxml2 (= 2.9.10+dfsg-6.3),
libzstd1 (= 1.4.5+dfsg-4+rpi1),
linux-libc-dev (= 5.9.6-1+rpi1+b1),
login (= 1:4.8.1-1),
lsb-base (= 11.1.0+rpi1),
m4 (= 1.4.18-5),
mailcap (= 3.68),
make (= 4.3-4),
man-db (= 2.9.3-2),
mawk (= 1.3.4.20200120-2),
media-types (= 1.1.0),
mime-support (= 3.66),
ncurses-base (= 6.2+20201114-1),
ncurses-bin (= 6.2+20201114-1),
passwd (= 1:4.8.1-1),
patch (= 2.7.6-6),
perl (= 5.32.0-6),
perl-base (= 5.32.0-6),
perl-modules-5.32 (= 5.32.0-6),
pinentry-curses (= 1.1.0-4),
po-debconf (= 1.0.21+nmu1),
procps (= 2:3.3.16-5),
python3 (= 3.9.1-1),
python3-all (= 3.9.1-1),
python3-all-dev (= 3.9.1-1),
python3-dev (= 3.9.1-1),
python3-distutils (= 3.9.1-2),
python3-lib2to3 (= 3.9.1-2),
python3-minimal (= 3.9.1-1),
python3-pkg-resources (= 51.1.0-1),
python3-setuptools (= 51.1.0-1),
python3.9 (= 3.9.1-1+rpi1),
python3.9-dev (= 3.9.1-1+rpi1),
python3.9-minimal (= 3.9.1-1+rpi1),
raspbian-archive-keyring (= 20120528.2),
readline-common (= 8.1-1),
rename (= 1.13-1),
sed (= 4.7-1),
sensible-utils (= 0.0.14),
sysvinit-utils (= 2.96-5),
tar (= 1.32+dfsg-1+rpi1),
tzdata (= 2020e-1),
util-linux (= 2.36.1-3),
xz-utils (= 5.2.4-1),
zlib1g (= 1:1.2.11.dfsg-2),
zlib1g-dev (= 1:1.2.11.dfsg-2)
Environment:
DEB_BUILD_OPTIONS="parallel=4"
LC_ALL="C.UTF-8"
SOURCE_DATE_EPOCH="1610465585"
+------------------------------------------------------------------------------+
| Package contents |
+------------------------------------------------------------------------------+
edlib-aligner-dbgsym_1.2.6-1_armhf.deb
--------------------------------------
new Debian package, version 2.0.
size 116744 bytes: control archive=544 bytes.
389 bytes, 12 lines control
106 bytes, 1 lines md5sums
Package: edlib-aligner-dbgsym
Source: libedlib
Version: 1.2.6-1
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 129
Depends: edlib-aligner (= 1.2.6-1)
Section: debug
Priority: optional
Description: debug symbols for edlib-aligner
Build-Ids: df0ecbac0a7b8accecb17295afe78c60685f83f9
drwxr-xr-x root/root 0 2021-01-12 15:33 ./
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/debug/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/debug/.build-id/df/
-rw-r--r-- root/root 121072 2021-01-12 15:33 ./usr/lib/debug/.build-id/df/0ecbac0a7b8accecb17295afe78c60685f83f9.debug
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/
lrwxrwxrwx root/root 0 2021-01-12 15:33 ./usr/share/doc/edlib-aligner-dbgsym -> edlib-aligner
edlib-aligner_1.2.6-1_armhf.deb
-------------------------------
new Debian package, version 2.0.
size 19308 bytes: control archive=1284 bytes.
1414 bytes, 31 lines control
545 bytes, 7 lines md5sums
Package: edlib-aligner
Source: libedlib
Version: 1.2.6-1
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 52
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2), libedlib0 (= 1.2.6-1)
Section: science
Priority: optional
Homepage: https://github.com/Martinsos/edlib
Description: edlib sequence alignment tool using edit distance
Edlib is a lightweight and super fast C/C++ library for sequence
alignment using edit distance. This package provides an aligner
using this library.
.
Features of libedlib
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
drwxr-xr-x root/root 0 2021-01-12 15:33 ./
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/bin/
-rwxr-xr-x root/root 34312 2021-01-12 15:33 ./usr/bin/edlib-aligner
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/edlib-aligner/
-rw-r--r-- root/root 697 2021-01-12 15:33 ./usr/share/doc/edlib-aligner/changelog.Debian.gz
-rw-r--r-- root/root 1343 2021-01-12 15:33 ./usr/share/doc/edlib-aligner/copyright
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/edlib-aligner/examples/
drwxr-xr-x root/root 0 2019-11-07 09:38 ./usr/share/doc/edlib-aligner/examples/test_data/
-rw-r--r-- root/root 112 2019-11-07 09:38 ./usr/share/doc/edlib-aligner/examples/test_data/query.fasta
-rw-r--r-- root/root 111 2019-11-07 09:38 ./usr/share/doc/edlib-aligner/examples/test_data/target.fasta
-rw-r--r-- root/root 334 2021-01-12 15:33 ./usr/share/doc/edlib-aligner/run-unit-test
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/man/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/man/man1/
-rw-r--r-- root/root 815 2021-01-12 15:33 ./usr/share/man/man1/edlib-aligner.1.gz
libedlib-dev_1.2.6-1_armhf.deb
------------------------------
new Debian package, version 2.0.
size 15904 bytes: control archive=1256 bytes.
1511 bytes, 36 lines control
362 bytes, 5 lines md5sums
Package: libedlib-dev
Source: libedlib
Version: 1.2.6-1
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 51
Depends: libedlib0 (= 1.2.6-1)
Section: libdevel
Priority: optional
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance (devel)
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the static library and the header files.
drwxr-xr-x root/root 0 2021-01-12 15:33 ./
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/include/
-rw-r--r-- root/root 10702 2019-11-07 09:38 ./usr/include/edlib.h
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/arm-linux-gnueabihf/
-rw-r--r-- root/root 24816 2021-01-12 15:33 ./usr/lib/arm-linux-gnueabihf/libedlib.a
lrwxrwxrwx root/root 0 2021-01-12 15:33 ./usr/lib/arm-linux-gnueabihf/libedlib.so -> libedlib.so.0
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/arm-linux-gnueabihf/pkgconfig/
-rw-r--r-- root/root 236 2021-01-12 15:33 ./usr/lib/arm-linux-gnueabihf/pkgconfig/edlib-1.pc
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/libedlib-dev/
-rw-r--r-- root/root 697 2021-01-12 15:33 ./usr/share/doc/libedlib-dev/changelog.Debian.gz
-rw-r--r-- root/root 1343 2021-01-12 15:33 ./usr/share/doc/libedlib-dev/copyright
libedlib0-dbgsym_1.2.6-1_armhf.deb
----------------------------------
new Debian package, version 2.0.
size 74348 bytes: control archive=536 bytes.
376 bytes, 12 lines control
106 bytes, 1 lines md5sums
Package: libedlib0-dbgsym
Source: libedlib
Version: 1.2.6-1
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 86
Depends: libedlib0 (= 1.2.6-1)
Section: debug
Priority: optional
Description: debug symbols for libedlib0
Build-Ids: a019644f146ac4e2d1e7944e9588281f9b7b939d
drwxr-xr-x root/root 0 2021-01-12 15:33 ./
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/debug/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/debug/.build-id/a0/
-rw-r--r-- root/root 77120 2021-01-12 15:33 ./usr/lib/debug/.build-id/a0/19644f146ac4e2d1e7944e9588281f9b7b939d.debug
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/
lrwxrwxrwx root/root 0 2021-01-12 15:33 ./usr/share/doc/libedlib0-dbgsym -> libedlib0
libedlib0_1.2.6-1_armhf.deb
---------------------------
new Debian package, version 2.0.
size 13644 bytes: control archive=1532 bytes.
1509 bytes, 36 lines control
226 bytes, 3 lines md5sums
32 bytes, 1 lines shlibs
729 bytes, 11 lines symbols
67 bytes, 2 lines triggers
Package: libedlib0
Source: libedlib
Version: 1.2.6-1
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 41
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2)
Section: libs
Priority: optional
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the shared library.
drwxr-xr-x root/root 0 2021-01-12 15:33 ./
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/arm-linux-gnueabihf/
lrwxrwxrwx root/root 0 2021-01-12 15:33 ./usr/lib/arm-linux-gnueabihf/libedlib.so.0 -> libedlib.so.1.2.5
-rw-r--r-- root/root 25960 2021-01-12 15:33 ./usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.5
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/libedlib0/
-rw-r--r-- root/root 697 2021-01-12 15:33 ./usr/share/doc/libedlib0/changelog.Debian.gz
-rw-r--r-- root/root 1343 2021-01-12 15:33 ./usr/share/doc/libedlib0/copyright
python3-edlib-dbgsym_1.2.6-1_armhf.deb
--------------------------------------
new Debian package, version 2.0.
size 269140 bytes: control archive=544 bytes.
389 bytes, 12 lines control
106 bytes, 1 lines md5sums
Package: python3-edlib-dbgsym
Source: libedlib
Version: 1.2.6-1
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 297
Depends: python3-edlib (= 1.2.6-1)
Section: debug
Priority: optional
Description: debug symbols for python3-edlib
Build-Ids: 710daf53a9e06a230ad0af07744e66ff96034d20
drwxr-xr-x root/root 0 2021-01-12 15:33 ./
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/debug/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/debug/.build-id/71/
-rw-r--r-- root/root 293436 2021-01-12 15:33 ./usr/lib/debug/.build-id/71/0daf53a9e06a230ad0af07744e66ff96034d20.debug
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/
lrwxrwxrwx root/root 0 2021-01-12 15:33 ./usr/share/doc/python3-edlib-dbgsym -> python3-edlib
python3-edlib_1.2.6-1_armhf.deb
-------------------------------
new Debian package, version 2.0.
size 51244 bytes: control archive=1360 bytes.
1571 bytes, 36 lines control
557 bytes, 6 lines md5sums
Package: python3-edlib
Source: libedlib
Version: 1.2.6-1
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 147
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2), python3 (<< 3.10), python3 (>= 3.9~)
Section: python
Priority: optional
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance (Python3 module)
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the Python3 module.
drwxr-xr-x root/root 0 2021-01-12 15:33 ./
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/python3/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/python3/dist-packages/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/lib/python3/dist-packages/edlib-1.3.6.egg-info/
-rw-r--r-- root/root 6425 2021-01-12 15:33 ./usr/lib/python3/dist-packages/edlib-1.3.6.egg-info/PKG-INFO
-rw-r--r-- root/root 1 2021-01-12 15:33 ./usr/lib/python3/dist-packages/edlib-1.3.6.egg-info/dependency_links.txt
-rw-r--r-- root/root 6 2021-01-12 15:33 ./usr/lib/python3/dist-packages/edlib-1.3.6.egg-info/top_level.txt
-rw-r--r-- root/root 127752 2021-01-12 15:33 ./usr/lib/python3/dist-packages/edlib.cpython-39-arm-linux-gnueabihf.so
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/
drwxr-xr-x root/root 0 2021-01-12 15:33 ./usr/share/doc/python3-edlib/
-rw-r--r-- root/root 697 2021-01-12 15:33 ./usr/share/doc/python3-edlib/changelog.Debian.gz
-rw-r--r-- root/root 1343 2021-01-12 15:33 ./usr/share/doc/python3-edlib/copyright
+------------------------------------------------------------------------------+
| Post Build |
+------------------------------------------------------------------------------+
+------------------------------------------------------------------------------+
| Cleanup |
+------------------------------------------------------------------------------+
Purging /<<BUILDDIR>>
Not cleaning session: cloned chroot in use
+------------------------------------------------------------------------------+
| Summary |
+------------------------------------------------------------------------------+
Build Architecture: armhf
Build Type: any
Build-Space: 21756
Build-Time: 52
Distribution: bullseye-staging
Host Architecture: armhf
Install-Time: 426
Job: libedlib_1.2.6-1
Machine Architecture: armhf
Package: libedlib
Package-Time: 508
Source-Version: 1.2.6-1
Space: 21756
Status: successful
Version: 1.2.6-1
--------------------------------------------------------------------------------
Finished at 2021-01-15T12:41:11Z
Build needed 00:08:28, 21756k disk space