fasta3 →
36.3.8i.14-Nov-2020-1 →
armhf → 2022-12-28 07:36:33
sbuild (Debian sbuild) 0.71.0 (24 Aug 2016) on bm-wb-02
+==============================================================================+
| fasta3 36.3.8i.14-Nov-2020-1 (armhf) Wed, 28 Dec 2022 06:46:53 +0000 |
+==============================================================================+
Package: fasta3
Version: 36.3.8i.14-Nov-2020-1
Source Version: 36.3.8i.14-Nov-2020-1
Distribution: bookworm-staging
Machine Architecture: armhf
Host Architecture: armhf
Build Architecture: armhf
I: NOTICE: Log filtering will replace 'var/lib/schroot/mount/bookworm-staging-armhf-sbuild-3f6c959c-5fbe-49ce-8541-22b43aef849f' with '<<CHROOT>>'
+------------------------------------------------------------------------------+
| Update chroot |
+------------------------------------------------------------------------------+
Get:1 http://172.17.4.1/private bookworm-staging InRelease [11.3 kB]
Get:2 http://172.17.4.1/private bookworm-staging/main Sources [13.5 MB]
Get:3 http://172.17.4.1/private bookworm-staging/main armhf Packages [14.3 MB]
Fetched 27.8 MB in 28s (982 kB/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
W: http://172.17.4.1/private/dists/bookworm-staging/InRelease: Key is stored in legacy trusted.gpg keyring (/etc/apt/trusted.gpg), see the DEPRECATION section in apt-key(8) for details.
+------------------------------------------------------------------------------+
| Fetch source files |
+------------------------------------------------------------------------------+
Check APT
---------
Checking available source versions...
Download source files with APT
------------------------------
Reading package lists...
NOTICE: 'fasta3' packaging is maintained in the 'Git' version control system at:
https://salsa.debian.org/med-team/fasta3.git
Please use:
git clone https://salsa.debian.org/med-team/fasta3.git
to retrieve the latest (possibly unreleased) updates to the package.
Need to get 1416 kB of source archives.
Get:1 http://172.17.4.1/private bookworm-staging/main fasta3 36.3.8i.14-Nov-2020-1 (dsc) [2224 B]
Get:2 http://172.17.4.1/private bookworm-staging/main fasta3 36.3.8i.14-Nov-2020-1 (tar) [1403 kB]
Get:3 http://172.17.4.1/private bookworm-staging/main fasta3 36.3.8i.14-Nov-2020-1 (diff) [10.8 kB]
Fetched 1416 kB in 0s (5910 kB/s)
Download complete and in download only mode
I: NOTICE: Log filtering will replace 'build/fasta3-11CMa9/fasta3-36.3.8i.14-Nov-2020' with '<<PKGBUILDDIR>>'
I: NOTICE: Log filtering will replace 'build/fasta3-11CMa9' with '<<BUILDDIR>>'
+------------------------------------------------------------------------------+
| Install build-essential |
+------------------------------------------------------------------------------+
Setup apt archive
-----------------
Merged Build-Depends: build-essential, fakeroot
Filtered Build-Depends: build-essential, fakeroot
dpkg-deb: building package 'sbuild-build-depends-core-dummy' in '/<<BUILDDIR>>/resolver-7FTWHu/apt_archive/sbuild-build-depends-core-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning: sbuild-build-depends-core-dummy
dpkg-scanpackages: info: Wrote 1 entries to output Packages file.
gpg: keybox '/<<BUILDDIR>>/resolver-7FTWHu/gpg/pubring.kbx' created
gpg: /<<BUILDDIR>>/resolver-7FTWHu/gpg/trustdb.gpg: trustdb created
gpg: key 35506D9A48F77B2E: public key "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" imported
gpg: Total number processed: 1
gpg: imported: 1
gpg: key 35506D9A48F77B2E: "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" not changed
gpg: key 35506D9A48F77B2E: secret key imported
gpg: Total number processed: 1
gpg: unchanged: 1
gpg: secret keys read: 1
gpg: secret keys imported: 1
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ Release [957 B]
Get:3 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ Sources [349 B]
Get:5 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ Packages [432 B]
Fetched 2108 B in 1s (2501 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...
Install core build dependencies (apt-based resolver)
----------------------------------------------------
Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
krb5-locales libldap-common libpam-cap netbase sensible-utils
Use 'apt autoremove' to remove them.
The following NEW packages will be installed:
sbuild-build-depends-core-dummy
0 upgraded, 1 newly installed, 0 to remove and 14 not upgraded.
Need to get 852 B of archives.
After this operation, 0 B of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ sbuild-build-depends-core-dummy 0.invalid.0 [852 B]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 852 B in 0s (23.1 kB/s)
Selecting previously unselected package sbuild-build-depends-core-dummy.
(Reading database ... 13212 files and directories currently installed.)
Preparing to unpack .../sbuild-build-depends-core-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-core-dummy (0.invalid.0) ...
Setting up sbuild-build-depends-core-dummy (0.invalid.0) ...
W: No sandbox user '_apt' on the system, can not drop privileges
+------------------------------------------------------------------------------+
| Check architectures |
+------------------------------------------------------------------------------+
Arch check ok (armhf included in any all)
+------------------------------------------------------------------------------+
| Install package build dependencies |
+------------------------------------------------------------------------------+
Setup apt archive
-----------------
Merged Build-Depends: debhelper-compat (= 13), libsimde-dev
Filtered Build-Depends: debhelper-compat (= 13), libsimde-dev
dpkg-deb: building package 'sbuild-build-depends-fasta3-dummy' in '/<<BUILDDIR>>/resolver-7FTWHu/apt_archive/sbuild-build-depends-fasta3-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning: sbuild-build-depends-core-dummy sbuild-build-depends-fasta3-dummy
dpkg-scanpackages: info: Wrote 2 entries to output Packages file.
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ Release [963 B]
Get:3 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ Sources [498 B]
Get:5 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ Packages [576 B]
Fetched 2407 B in 1s (3305 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...
Install fasta3 build dependencies (apt-based resolver)
------------------------------------------------------
Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
krb5-locales libldap-common libpam-cap netbase
Use 'apt autoremove' to remove them.
The following additional packages will be installed:
autoconf automake autopoint autotools-dev bsdextrautils debhelper
dh-autoreconf dh-strip-nondeterminism dwz file gettext gettext-base
groff-base intltool-debian libarchive-zip-perl libdebhelper-perl libelf1
libfile-stripnondeterminism-perl libicu72 libmagic-mgc libmagic1
libpipeline1 libsimde-dev libsub-override-perl libtool libuchardet0 libxml2
m4 man-db po-debconf
Suggested packages:
autoconf-archive gnu-standards autoconf-doc dh-make gettext-doc
libasprintf-dev libgettextpo-dev groff libtool-doc gfortran
| fortran95-compiler gcj-jdk m4-doc apparmor less www-browser
libmail-box-perl
Recommended packages:
curl | wget | lynx libarchive-cpio-perl libltdl-dev libmail-sendmail-perl
The following NEW packages will be installed:
autoconf automake autopoint autotools-dev bsdextrautils debhelper
dh-autoreconf dh-strip-nondeterminism dwz file gettext gettext-base
groff-base intltool-debian libarchive-zip-perl libdebhelper-perl libelf1
libfile-stripnondeterminism-perl libicu72 libmagic-mgc libmagic1
libpipeline1 libsimde-dev libsub-override-perl libtool libuchardet0 libxml2
m4 man-db po-debconf sbuild-build-depends-fasta3-dummy
0 upgraded, 31 newly installed, 0 to remove and 14 not upgraded.
Need to get 18.2 MB of archives.
After this operation, 75.3 MB of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-7FTWHu/apt_archive ./ sbuild-build-depends-fasta3-dummy 0.invalid.0 [868 B]
Get:2 http://172.17.4.1/private bookworm-staging/main armhf libuchardet0 armhf 0.0.7-1 [65.0 kB]
Get:3 http://172.17.4.1/private bookworm-staging/main armhf groff-base armhf 1.22.4-9 [774 kB]
Get:4 http://172.17.4.1/private bookworm-staging/main armhf bsdextrautils armhf 2.38.1-4 [78.8 kB]
Get:5 http://172.17.4.1/private bookworm-staging/main armhf libpipeline1 armhf 1.5.7-1 [33.4 kB]
Get:6 http://172.17.4.1/private bookworm-staging/main armhf man-db armhf 2.11.1-1 [1341 kB]
Get:7 http://172.17.4.1/private bookworm-staging/main armhf libmagic-mgc armhf 1:5.41-4 [295 kB]
Get:8 http://172.17.4.1/private bookworm-staging/main armhf libmagic1 armhf 1:5.41-4 [120 kB]
Get:9 http://172.17.4.1/private bookworm-staging/main armhf file armhf 1:5.41-4 [65.8 kB]
Get:10 http://172.17.4.1/private bookworm-staging/main armhf gettext-base armhf 0.21-10 [156 kB]
Get:11 http://172.17.4.1/private bookworm-staging/main armhf m4 armhf 1.4.19-1 [260 kB]
Get:12 http://172.17.4.1/private bookworm-staging/main armhf autoconf all 2.71-2 [343 kB]
Get:13 http://172.17.4.1/private bookworm-staging/main armhf autotools-dev all 20220109.1 [51.6 kB]
Get:14 http://172.17.4.1/private bookworm-staging/main armhf automake all 1:1.16.5-1.3 [823 kB]
Get:15 http://172.17.4.1/private bookworm-staging/main armhf autopoint all 0.21-10 [495 kB]
Get:16 http://172.17.4.1/private bookworm-staging/main armhf libdebhelper-perl all 13.11.3 [81.1 kB]
Get:17 http://172.17.4.1/private bookworm-staging/main armhf libtool all 2.4.7-5 [517 kB]
Get:18 http://172.17.4.1/private bookworm-staging/main armhf dh-autoreconf all 20 [17.1 kB]
Get:19 http://172.17.4.1/private bookworm-staging/main armhf libarchive-zip-perl all 1.68-1 [104 kB]
Get:20 http://172.17.4.1/private bookworm-staging/main armhf libsub-override-perl all 0.09-4 [9304 B]
Get:21 http://172.17.4.1/private bookworm-staging/main armhf libfile-stripnondeterminism-perl all 1.13.0-2 [19.4 kB]
Get:22 http://172.17.4.1/private bookworm-staging/main armhf dh-strip-nondeterminism all 1.13.0-2 [8556 B]
Get:23 http://172.17.4.1/private bookworm-staging/main armhf libelf1 armhf 0.187-2+rpi2 [177 kB]
Get:24 http://172.17.4.1/private bookworm-staging/main armhf dwz armhf 0.14+20220924-2 [93.1 kB]
Get:25 http://172.17.4.1/private bookworm-staging/main armhf libicu72 armhf 72.1-3 [9009 kB]
Get:26 http://172.17.4.1/private bookworm-staging/main armhf libxml2 armhf 2.9.14+dfsg-1.1 [570 kB]
Get:27 http://172.17.4.1/private bookworm-staging/main armhf gettext armhf 0.21-10 [1203 kB]
Get:28 http://172.17.4.1/private bookworm-staging/main armhf intltool-debian all 0.35.0+20060710.6 [22.9 kB]
Get:29 http://172.17.4.1/private bookworm-staging/main armhf po-debconf all 1.0.21+nmu1 [248 kB]
Get:30 http://172.17.4.1/private bookworm-staging/main armhf debhelper all 13.11.3 [942 kB]
Get:31 http://172.17.4.1/private bookworm-staging/main armhf libsimde-dev all 0.7.2-6 [259 kB]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 18.2 MB in 2s (9110 kB/s)
Selecting previously unselected package libuchardet0:armhf.
(Reading database ... 13212 files and directories currently installed.)
Preparing to unpack .../00-libuchardet0_0.0.7-1_armhf.deb ...
Unpacking libuchardet0:armhf (0.0.7-1) ...
Selecting previously unselected package groff-base.
Preparing to unpack .../01-groff-base_1.22.4-9_armhf.deb ...
Unpacking groff-base (1.22.4-9) ...
Selecting previously unselected package bsdextrautils.
Preparing to unpack .../02-bsdextrautils_2.38.1-4_armhf.deb ...
Unpacking bsdextrautils (2.38.1-4) ...
Selecting previously unselected package libpipeline1:armhf.
Preparing to unpack .../03-libpipeline1_1.5.7-1_armhf.deb ...
Unpacking libpipeline1:armhf (1.5.7-1) ...
Selecting previously unselected package man-db.
Preparing to unpack .../04-man-db_2.11.1-1_armhf.deb ...
Unpacking man-db (2.11.1-1) ...
Selecting previously unselected package libmagic-mgc.
Preparing to unpack .../05-libmagic-mgc_1%3a5.41-4_armhf.deb ...
Unpacking libmagic-mgc (1:5.41-4) ...
Selecting previously unselected package libmagic1:armhf.
Preparing to unpack .../06-libmagic1_1%3a5.41-4_armhf.deb ...
Unpacking libmagic1:armhf (1:5.41-4) ...
Selecting previously unselected package file.
Preparing to unpack .../07-file_1%3a5.41-4_armhf.deb ...
Unpacking file (1:5.41-4) ...
Selecting previously unselected package gettext-base.
Preparing to unpack .../08-gettext-base_0.21-10_armhf.deb ...
Unpacking gettext-base (0.21-10) ...
Selecting previously unselected package m4.
Preparing to unpack .../09-m4_1.4.19-1_armhf.deb ...
Unpacking m4 (1.4.19-1) ...
Selecting previously unselected package autoconf.
Preparing to unpack .../10-autoconf_2.71-2_all.deb ...
Unpacking autoconf (2.71-2) ...
Selecting previously unselected package autotools-dev.
Preparing to unpack .../11-autotools-dev_20220109.1_all.deb ...
Unpacking autotools-dev (20220109.1) ...
Selecting previously unselected package automake.
Preparing to unpack .../12-automake_1%3a1.16.5-1.3_all.deb ...
Unpacking automake (1:1.16.5-1.3) ...
Selecting previously unselected package autopoint.
Preparing to unpack .../13-autopoint_0.21-10_all.deb ...
Unpacking autopoint (0.21-10) ...
Selecting previously unselected package libdebhelper-perl.
Preparing to unpack .../14-libdebhelper-perl_13.11.3_all.deb ...
Unpacking libdebhelper-perl (13.11.3) ...
Selecting previously unselected package libtool.
Preparing to unpack .../15-libtool_2.4.7-5_all.deb ...
Unpacking libtool (2.4.7-5) ...
Selecting previously unselected package dh-autoreconf.
Preparing to unpack .../16-dh-autoreconf_20_all.deb ...
Unpacking dh-autoreconf (20) ...
Selecting previously unselected package libarchive-zip-perl.
Preparing to unpack .../17-libarchive-zip-perl_1.68-1_all.deb ...
Unpacking libarchive-zip-perl (1.68-1) ...
Selecting previously unselected package libsub-override-perl.
Preparing to unpack .../18-libsub-override-perl_0.09-4_all.deb ...
Unpacking libsub-override-perl (0.09-4) ...
Selecting previously unselected package libfile-stripnondeterminism-perl.
Preparing to unpack .../19-libfile-stripnondeterminism-perl_1.13.0-2_all.deb ...
Unpacking libfile-stripnondeterminism-perl (1.13.0-2) ...
Selecting previously unselected package dh-strip-nondeterminism.
Preparing to unpack .../20-dh-strip-nondeterminism_1.13.0-2_all.deb ...
Unpacking dh-strip-nondeterminism (1.13.0-2) ...
Selecting previously unselected package libelf1:armhf.
Preparing to unpack .../21-libelf1_0.187-2+rpi2_armhf.deb ...
Unpacking libelf1:armhf (0.187-2+rpi2) ...
Selecting previously unselected package dwz.
Preparing to unpack .../22-dwz_0.14+20220924-2_armhf.deb ...
Unpacking dwz (0.14+20220924-2) ...
Selecting previously unselected package libicu72:armhf.
Preparing to unpack .../23-libicu72_72.1-3_armhf.deb ...
Unpacking libicu72:armhf (72.1-3) ...
Selecting previously unselected package libxml2:armhf.
Preparing to unpack .../24-libxml2_2.9.14+dfsg-1.1_armhf.deb ...
Unpacking libxml2:armhf (2.9.14+dfsg-1.1) ...
Selecting previously unselected package gettext.
Preparing to unpack .../25-gettext_0.21-10_armhf.deb ...
Unpacking gettext (0.21-10) ...
Selecting previously unselected package intltool-debian.
Preparing to unpack .../26-intltool-debian_0.35.0+20060710.6_all.deb ...
Unpacking intltool-debian (0.35.0+20060710.6) ...
Selecting previously unselected package po-debconf.
Preparing to unpack .../27-po-debconf_1.0.21+nmu1_all.deb ...
Unpacking po-debconf (1.0.21+nmu1) ...
Selecting previously unselected package debhelper.
Preparing to unpack .../28-debhelper_13.11.3_all.deb ...
Unpacking debhelper (13.11.3) ...
Selecting previously unselected package libsimde-dev.
Preparing to unpack .../29-libsimde-dev_0.7.2-6_all.deb ...
Unpacking libsimde-dev (0.7.2-6) ...
Selecting previously unselected package sbuild-build-depends-fasta3-dummy.
Preparing to unpack .../30-sbuild-build-depends-fasta3-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-fasta3-dummy (0.invalid.0) ...
Setting up libpipeline1:armhf (1.5.7-1) ...
Setting up libsimde-dev (0.7.2-6) ...
Setting up libicu72:armhf (72.1-3) ...
Setting up bsdextrautils (2.38.1-4) ...
Setting up libmagic-mgc (1:5.41-4) ...
Setting up libarchive-zip-perl (1.68-1) ...
Setting up libdebhelper-perl (13.11.3) ...
Setting up libmagic1:armhf (1:5.41-4) ...
Setting up gettext-base (0.21-10) ...
Setting up m4 (1.4.19-1) ...
Setting up file (1:5.41-4) ...
Setting up autotools-dev (20220109.1) ...
Setting up autopoint (0.21-10) ...
Setting up autoconf (2.71-2) ...
Setting up libuchardet0:armhf (0.0.7-1) ...
Setting up libsub-override-perl (0.09-4) ...
Setting up libelf1:armhf (0.187-2+rpi2) ...
Setting up libxml2:armhf (2.9.14+dfsg-1.1) ...
Setting up automake (1:1.16.5-1.3) ...
update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode
Setting up libfile-stripnondeterminism-perl (1.13.0-2) ...
Setting up gettext (0.21-10) ...
Setting up libtool (2.4.7-5) ...
Setting up intltool-debian (0.35.0+20060710.6) ...
Setting up dh-autoreconf (20) ...
Setting up dh-strip-nondeterminism (1.13.0-2) ...
Setting up dwz (0.14+20220924-2) ...
Setting up groff-base (1.22.4-9) ...
Setting up po-debconf (1.0.21+nmu1) ...
Setting up man-db (2.11.1-1) ...
Not building database; man-db/auto-update is not 'true'.
Setting up debhelper (13.11.3) ...
Setting up sbuild-build-depends-fasta3-dummy (0.invalid.0) ...
Processing triggers for libc-bin (2.36-6+rpi1) ...
W: No sandbox user '_apt' on the system, can not drop privileges
+------------------------------------------------------------------------------+
| Build environment |
+------------------------------------------------------------------------------+
Kernel: Linux 4.9.0-0.bpo.6-armmp armhf (armv7l)
Toolchain package versions: binutils_2.39.50.20221208-5+rpi1 dpkg-dev_1.21.9+rpi1 g++-12_12.2.0-10+rpi1 gcc-12_12.2.0-10+rpi1 libc6-dev_2.36-6+rpi1 libstdc++-12-dev_12.2.0-10+rpi1 libstdc++6_12.2.0-10+rpi1 linux-libc-dev_6.0.12-1+rpi1
Package versions: adduser_3.129 apt_2.5.4 aptitude_0.8.13-5 aptitude-common_0.8.13-5 autoconf_2.71-2 automake_1:1.16.5-1.3 autopoint_0.21-10 autotools-dev_20220109.1 base-files_12.3+rpi1 base-passwd_3.6.1 bash_5.2-2 binutils_2.39.50.20221208-5+rpi1 binutils-arm-linux-gnueabihf_2.39.50.20221208-5+rpi1 binutils-common_2.39.50.20221208-5+rpi1 bsdextrautils_2.38.1-4 bsdutils_1:2.38.1-4 build-essential_12.9 bzip2_1.0.8-5+b2 coreutils_9.1-1 cpp_4:12.2.0-1+rpi1 cpp-12_12.2.0-10+rpi1 dash_0.5.11+git20210903+057cd650a4ed-9 debconf_1.5.80 debhelper_13.11.3 debianutils_5.7-0.4 dh-autoreconf_20 dh-strip-nondeterminism_1.13.0-2 diffutils_1:3.8-1 dirmngr_2.2.40-1 dpkg_1.21.9+rpi1 dpkg-dev_1.21.9+rpi1 dwz_0.14+20220924-2 e2fsprogs_1.46.6~rc1-1 fakeroot_1.29-1 file_1:5.41-4 findutils_4.9.0-3 g++_4:12.2.0-1+rpi1 g++-12_12.2.0-10+rpi1 gcc_4:12.2.0-1+rpi1 gcc-12_12.2.0-10+rpi1 gcc-12-base_12.2.0-10+rpi1 gcc-7-base_7.5.0-6+rpi1+b2 gcc-8-base_8.4.0-7+rpi1 gcc-9-base_9.4.0-2+rpi1 gettext_0.21-10 gettext-base_0.21-10 gnupg_2.2.40-1 gnupg-l10n_2.2.40-1 gnupg-utils_2.2.40-1 gpg_2.2.40-1 gpg-agent_2.2.40-1 gpg-wks-client_2.2.40-1 gpg-wks-server_2.2.40-1 gpgconf_2.2.40-1 gpgsm_2.2.40-1 gpgv_2.2.40-1 grep_3.8-3 groff-base_1.22.4-9 gzip_1.12-1 hostname_3.23 init-system-helpers_1.64 intltool-debian_0.35.0+20060710.6 iputils-ping_3:20221126-1 krb5-locales_1.20.1-1 libacl1_2.3.1-2 libapt-pkg6.0_2.5.4 libarchive-zip-perl_1.68-1 libasan8_12.2.0-10+rpi1 libassuan0_2.5.5-5 libatomic1_12.2.0-10+rpi1 libattr1_1:2.5.1-3 libaudit-common_1:3.0.7-1.1 libaudit1_1:3.0.7-1.1 libbinutils_2.39.50.20221208-5+rpi1 libblkid1_2.38.1-4 libboost-iostreams1.74.0_1.74.0-17+b1 libbz2-1.0_1.0.8-5+b2 libc-bin_2.36-6+rpi1 libc-dev-bin_2.36-6+rpi1 libc6_2.36-6+rpi1 libc6-dev_2.36-6+rpi1 libcap-ng0_0.8.3-1 libcap2_1:2.44-1 libcap2-bin_1:2.44-1 libcc1-0_12.2.0-10+rpi1 libcom-err2_1.46.6~rc1-1 libcrypt-dev_1:4.4.33-1 libcrypt1_1:4.4.33-1 libctf-nobfd0_2.39.50.20221208-5+rpi1 libctf0_2.39.50.20221208-5+rpi1 libcwidget4_0.5.18-6 libdb5.3_5.3.28+dfsg1-0.10 libdebconfclient0_0.265 libdebhelper-perl_13.11.3 libdpkg-perl_1.21.9+rpi1 libelf1_0.187-2+rpi2 libext2fs2_1.46.6~rc1-1 libfakeroot_1.29-1 libffi8_3.4.4-1 libfile-stripnondeterminism-perl_1.13.0-2 libgcc-12-dev_12.2.0-10+rpi1 libgcc-s1_12.2.0-10+rpi1 libgcrypt20_1.10.1-3 libgdbm-compat4_1.23-3 libgdbm6_1.23-3 libgmp10_2:6.2.1+dfsg1-1.1 libgnutls30_3.7.8-4 libgomp1_12.2.0-10+rpi1 libgpg-error0_1.46-1 libgssapi-krb5-2_1.20.1-1 libhogweed6_3.8.1-2 libicu72_72.1-3 libidn2-0_2.3.3-1 libisl23_0.25-1 libjansson4_2.14-2 libk5crypto3_1.20.1-1 libkeyutils1_1.6.3-1 libkrb5-3_1.20.1-1 libkrb5support0_1.20.1-1 libksba8_1.6.2-4 libldap-2.4-2_2.4.59+dfsg-1+b1 libldap-2.5-0_2.5.13+dfsg-2+rpi1+b1 libldap-common_2.5.13+dfsg-2+rpi1 liblz4-1_1.9.4-1+rpi1 liblzma5_5.4.0-0.1 libmagic-mgc_1:5.41-4 libmagic1_1:5.41-4 libmount1_2.38.1-4 libmpc3_1.2.1-2 libmpfr6_4.1.0-3 libncursesw6_6.3+20220423-2 libnettle8_3.8.1-2 libnpth0_1.6-3 libnsl-dev_1.3.0-2 libnsl2_1.3.0-2 libp11-kit0_0.24.1-1 libpam-cap_1:2.44-1 libpam-modules_1.5.2-5 libpam-modules-bin_1.5.2-5 libpam-runtime_1.5.2-5 libpam0g_1.5.2-5 libpcre2-8-0_10.40-3 libpcre3_2:8.39-14 libperl5.36_5.36.0-6 libpipeline1_1.5.7-1 libreadline8_8.2-1.2 libsasl2-2_2.1.28+dfsg-10 libsasl2-modules-db_2.1.28+dfsg-10 libseccomp2_2.5.4-1+rpi1 libselinux1_3.4-1 libsemanage-common_3.4-1 libsemanage2_3.4-1 libsepol1_3.1-1 libsepol2_3.4-2 libsigc++-2.0-0v5_2.10.8-1 libsimde-dev_0.7.2-6 libsmartcols1_2.38.1-4 libsqlite3-0_3.40.0-1 libss2_1.46.6~rc1-1 libssl1.1_1.1.1o-1 libssl3_3.0.7-1 libstdc++-12-dev_12.2.0-10+rpi1 libstdc++6_12.2.0-10+rpi1 libsub-override-perl_0.09-4 libsystemd0_252.2-1+rpi1 libtasn1-6_4.19.0-2 libtinfo6_6.3+20220423-2 libtirpc-common_1.3.3+ds-1 libtirpc-dev_1.3.3+ds-1 libtirpc3_1.3.3+ds-1 libtool_2.4.7-5 libubsan1_12.2.0-10+rpi1 libuchardet0_0.0.7-1 libudev1_252.2-1+rpi1 libunistring2_1.0-2 libuuid1_2.38.1-4 libxapian30_1.4.21-1 libxml2_2.9.14+dfsg-1.1 libxxhash0_0.8.1-1 libzstd1_1.5.2+dfsg-1 linux-libc-dev_6.0.12-1+rpi1 login_1:4.13+dfsg1-1 logsave_1.46.6~rc1-1 lsb-base_11.4+rpi1 m4_1.4.19-1 make_4.3-4.1 man-db_2.11.1-1 mawk_1.3.4.20200120-3.1 mount_2.38.1-4 nano_7.1-1 ncurses-base_6.3+20220423-2 ncurses-bin_6.3+20220423-2 netbase_6.4 passwd_1:4.13+dfsg1-1 patch_2.7.6-7 perl_5.36.0-6 perl-base_5.36.0-6 perl-modules-5.36_5.36.0-6 pinentry-curses_1.2.1-1 po-debconf_1.0.21+nmu1 raspbian-archive-keyring_20120528.2 readline-common_8.2-1.2 rpcsvc-proto_1.4.3-1 sbuild-build-depends-core-dummy_0.invalid.0 sbuild-build-depends-fasta3-dummy_0.invalid.0 sed_4.8-1 sensible-utils_0.0.17 sgml-base_1.31 sysvinit-utils_3.05-7 tar_1.34+dfsg-1 tzdata_2022f-1 util-linux_2.38.1-4 util-linux-extra_2.38.1-4 xz-utils_5.4.0-0.1 zlib1g_1:1.2.13.dfsg-1
+------------------------------------------------------------------------------+
| Build |
+------------------------------------------------------------------------------+
Unpack source
-------------
gpgv: unknown type of key resource 'trustedkeys.kbx'
gpgv: keyblock resource '/tmp/dpkg-verify-sig.MNzAStpi/trustedkeys.kbx': General error
gpgv: Signature made Sun Dec 25 18:25:32 2022 UTC
gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1
gpgv: issuer "tille@debian.org"
gpgv: Can't check signature: No public key
dpkg-source: warning: cannot verify signature ./fasta3_36.3.8i.14-Nov-2020-1.dsc
dpkg-source: info: extracting fasta3 in /<<PKGBUILDDIR>>
dpkg-source: info: unpacking fasta3_36.3.8i.14-Nov-2020.orig.tar.gz
dpkg-source: info: unpacking fasta3_36.3.8i.14-Nov-2020-1.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying Makefile.patch
dpkg-source: info: applying local_tests
dpkg-source: info: applying adjust-scripts
Check disc space
----------------
Sufficient free space for build
User Environment
----------------
APT_CONFIG=/var/lib/sbuild/apt.conf
DEB_BUILD_OPTIONS=parallel=4
HOME=/sbuild-nonexistent
LC_ALL=POSIX
LOGNAME=buildd
PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games
SCHROOT_ALIAS_NAME=bookworm-staging-armhf-sbuild
SCHROOT_CHROOT_NAME=bookworm-staging-armhf-sbuild
SCHROOT_COMMAND=env
SCHROOT_GID=109
SCHROOT_GROUP=buildd
SCHROOT_SESSION_ID=bookworm-staging-armhf-sbuild-3f6c959c-5fbe-49ce-8541-22b43aef849f
SCHROOT_UID=104
SCHROOT_USER=buildd
SHELL=/bin/sh
TERM=xterm
USER=buildd
dpkg-buildpackage
-----------------
dpkg-buildpackage: info: source package fasta3
dpkg-buildpackage: info: source version 36.3.8i.14-Nov-2020-1
dpkg-buildpackage: info: source distribution unstable
dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
debian/rules clean
dh clean --sourcedirectory src
debian/rules override_dh_auto_clean
make[1]: Entering directory '/<<PKGBUILDDIR>>'
if [ -d src ]; then cd src && /usr/bin/make -f "../make/Makefile.linux64" clean-up; fi
make[2]: Entering directory '/<<PKGBUILDDIR>>/src'
rm -f *.o fasta36 ssearch36 lalign36 fasts36 fastx36 tfastx36 fasty36 tfasty36 tfasts36 fastm36 tfastm36 fastf36 tfastf36 glsearch36 ggsearch36 map_db; rm -rf ../bin/*
make[2]: Leaving directory '/<<PKGBUILDDIR>>/src'
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
dh_autoreconf_clean -O--sourcedirectory=src
dh_clean -O--sourcedirectory=src
debian/rules binary-arch
dh binary-arch --sourcedirectory src
dh_update_autotools_config -a -O--sourcedirectory=src
dh_autoreconf -a -O--sourcedirectory=src
dh_auto_configure -a -O--sourcedirectory=src
debian/rules override_dh_auto_build
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_build --sourcedirectory make --builddirectory src --buildsystem makefile -- -f "../make/Makefile.linux64"
cd src && make -j4 "INSTALL=install --strip-program=true" -f ../make/Makefile.linux64
make[2]: Entering directory '/<<PKGBUILDDIR>>/src'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -DCOMP_MLIB -c comp_lib9.c -o comp_mthr9.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c work_thr2.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c pthr_subs2.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -DCOMP_MLIB -c compacc2e.c -o compacc2_t.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mshowbest.c -o showbest.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c build_ares.c -o build_ares.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c re_getlib.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -c mshowalign2.c -o mshowalign2_t.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c htime.c
mshowalign2.c: In function 'showalign':
mshowalign2.c:617:64: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
mshowalign2.c:617:68: warning: format '%lu' expects argument of type 'long unsigned int', but argument 6 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c apam.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c doinit.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTA initfa.c -o init_fa.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DLOCAL_SCORE -c scaleswn.c -o scale_se.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c karlin.c
scaleswn.c: In function 'process_hist':
scaleswn.c:255:55: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
255 | fprintf(stderr," cannot allocate pstat_union: %ld\n",sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| | unsigned int
| long int
| %d
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnfa.c -o drop_nfa.o
cc -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -Wdate-time -D_FORTIFY_SOURCE=2 -c -o wm_align.o wm_align.c
dropnfa.c: In function 'init_work':
dropnfa.c:306:77: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
306 | fprintf (stderr,"*** ERROR [%s:%d] - cannot allocate diagonal arrays: %lu\n",
| ~~^
| |
| long unsigned int
| %u
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTA -c cal_cons2.c -o calcons_fa.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c nmgetlib.c -o lgetlib.o
nmgetlib.c: In function 'open_lib':
nmgetlib.c:414:76: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
414 | fprintf(stderr,"\n*** Warning [%s:%d] - cannot allocate lmf_str (%ld) for %s\n",
| ~~^
| |
| long int
| %d
415 | __FILE__, __LINE__,sizeof(struct lmf_str),lib_p->file_name);
| ~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mmgetaa.c -o lgetaa_m.o
nmgetlib.c: In function 'sel_hacc_libstr_init':
nmgetlib.c:2025:71: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2025 | fprintf(stderr, "*** Warning [%s:%d] - cannot allocate acc_hash[%ld]\n",__FILE__, __LINE__,hash_max*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
nmgetlib.c:2031:76: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2031 | fprintf(stderr, "*** Warning [%s:%d] - cannot allocate acc_hash_link[%ld]\n",__FILE__, __LINE__,acc_cnt*sizeof(char *));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
nmgetlib.c: In function 'sel_hacc_gi_init':
nmgetlib.c:2152:70: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2152 | fprintf(stderr, "*** Warning [%s:%d] - cannot allocate gi_hash[%ld]\n",__FILE__, __LINE__,hash_max*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
nmgetlib.c:2158:75: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2158 | fprintf(stderr, "*** Warning [%s:%d] - cannot allocate gi_hash_link[%ld]\n",__FILE__, __LINE__,acc_cnt*sizeof(char *));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
nmgetlib.c: In function 'agetlib':
nmgetlib.c:636:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
636 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:638:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
638 | fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:681:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
681 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:696:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
696 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'aranlib':
nmgetlib.c:716:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
716 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'qgetlib':
nmgetlib.c:778:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
778 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:780:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
780 | fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:811:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
811 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'qranlib':
nmgetlib.c:834:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
834 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'lgetlib':
nmgetlib.c:887:7: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
887 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:925:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
925 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'lget_ann':
nmgetlib.c:949:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
949 | fgets(desc,sizeof(desc),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:951:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
951 | fgets(desc,sizeof(desc),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:955:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
955 | fgets(acc,sizeof(acc),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:957:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
957 | fgets(acc,sizeof(acc),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:965:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
965 | fgets(ver,sizeof(ver),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:967:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
967 | fgets(ver,sizeof(ver),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'lranlib':
nmgetlib.c:1041:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1041 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1048:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1048 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'pgetlib':
nmgetlib.c:1086:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1086 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); /* get the extra line */
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1108:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1108 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'pranlib':
nmgetlib.c:1132:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1132 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1135:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1135 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1137:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1137 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1143:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1143 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'egetlib':
nmgetlib.c:1227:1: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1227 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'eranlib':
nmgetlib.c:1257:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1257 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1262:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1262 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1265:56: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1265 | while (lm_fd->lline[0]!='D' || lm_fd->lline[1]!='E') fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1272:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1272 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'igetlib':
nmgetlib.c:1305:19: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1305 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1336:13: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1336 | fgets(lm_fd->lline,MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1340:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1340 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'iranlib':
nmgetlib.c:1367:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1367 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1378:11: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1378 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1387:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1387 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'vgetlib':
nmgetlib.c:1425:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1425 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1464:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1464 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1470:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1470 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c c_dispn.c
nmgetlib.c: In function 'vranlib':
nmgetlib.c:1497:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1497 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1511:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1511 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1528:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1528 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'gcg_getlib':
nmgetlib.c:1570:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1570 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1573:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1573 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1575:7: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1575 | fgets(&lm_fd->lline[strlen(lm_fd->lline)-MAX_STR/2],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1595:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
1595 | fread((char *)seqp,(size_t)r_block,(size_t)1,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1610:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1610 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'gcg_ranlib':
nmgetlib.c:1634:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1634 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1643:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1643 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1674:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
1674 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c ncbl2_mlib.c -o ncbl2_mlib.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c lib_sel.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c url_subs.c
ncbl2_mlib.c: In function 'ncbl2_getlibn':
ncbl2_mlib.c:1434:80: warning: format '%ld' expects argument of type 'long int', but argument 7 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
1434 | "*** ERROR [%s:%d] - could not read sequence record: %s %lld %ld != %ld: %d\n",
| ~~^
| |
| long int
| %d
1435 | __FILE__,__LINE__,libstr, *libpos,tmp,seqcnt,*seq);
| ~~~
| |
| size_t {aka unsigned int}
ncbl2_mlib.c:1454:84: warning: format '%ld' expects argument of type 'long int', but argument 6 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
1454 | fprintf(stderr,"*** ERROR [%s:%d] - could not read sequence record: %lld %ld/%ld\n",
| ~~^
| |
| long int
| %d
1455 | __FILE__,__LINE__, *libpos,tmp,seqcnt);
| ~~~
| |
| size_t {aka unsigned int}
ncbl2_mlib.c:1594:72: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
1594 | fprintf(stderr, "*** ERROR [%s:%d] malloc amb table error size %ld\n",
| ~~^
| |
| long int
| %d
1595 | __FILE__, __LINE__, amb_cnt * sizeof(unsigned int));
| ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
ncbl2_mlib.c: In function 'load_ncbl2':
ncbl2_mlib.c:810:5: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
810 | fread(title_str,(size_t)1,(size_t)title_len,ifile);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:820:7: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
820 | fread(pdb_title_str,(size_t)1,(size_t)pdb_title_len,ifile);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:831:5: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
831 | fread(date_str,(size_t)1,(size_t)date_len,ifile);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'ncbl2_ranlib':
ncbl2_mlib.c:1720:5: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
1720 | fread(str,(size_t)1,(size_t)(llen),m_fd->hfile);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:1735:5: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
1735 | fread(my_buff,(size_t)1,llen,m_fd->hfile);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_int4_read':
ncbl2_mlib.c:1841:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
1841 | fread((char *)&b[0],(size_t)1,(size_t)4,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_long4_read':
ncbl2_mlib.c:1856:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
1856 | fread((char *)&b[0],(size_t)1,(size_t)4,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_uint4_read':
ncbl2_mlib.c:1869:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
1869 | fread((char *)&b[0],(size_t)1,(size_t)4,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_long8_read':
ncbl2_mlib.c:1884:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
1884 | fread((char *)&b[0],(size_t)1,(size_t)8,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'ncbi_long8_read':
ncbl2_mlib.c:1904:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
1904 | fread((char *)&b[0],(size_t)1,(size_t)8,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_char_read':
ncbl2_mlib.c:1911:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
1911 | fread(val,(size_t)1,(size_t)1,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_fstr_read':
ncbl2_mlib.c:1916:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
1916 | fread(val,(size_t)slen,(size_t)1,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -Wdate-time -D_FORTIFY_SOURCE=2 -c -o mrandom.o mrandom.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DSSEARCH initfa.c -o init_sw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o dropgsw2_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c smith_waterman_sse2.c
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c wm_align.c -o lwm_align.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSSEARCH -c cal_cons2.c -o calcons_sw.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c pssm_asn_subs.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_MLIB -c comp_lib9.c -o comp_mlib9.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_MLIB -c compacc2e.c -o compacc2_s.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DLALIGN -c mshowalign2.c -o lshowalign.o
mshowalign2.c: In function 'showalign':
mshowalign2.c:617:64: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
mshowalign2.c:617:68: warning: format '%lu' expects argument of type 'long unsigned int', but argument 6 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DLALIGN initfa.c -o init_lal.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c last_thresh.c
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o droplal2_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c lsim4.c
lsim4.c: In function 'ckalloc':
lsim4.c:994:47: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
994 | fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
| ~~^ ~~~~~~
| | |
| long int size_t {aka unsigned int}
| %d
lsim4.c:994:51: warning: format '%ld' expects argument of type 'long int', but argument 4 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
994 | fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
| ~~^ ~~~~
| | |
| long int size_t {aka unsigned int}
| %d
lsim4.c:994:55: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
994 | fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
| ~~^ ~~~~~~
| | |
| long int size_t {aka unsigned int}
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -DLCAL_CONS -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c cal_cons2.c -o calcons_la.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS initfa.c -o init_fs.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c scaleswt.c -o scaleswts.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c last_tat.c
scaleswt.c: In function 'process_hist':
scaleswt.c:184:72: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
184 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate rs_snion: %ld\n",__FILE__, __LINE__, sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
scaleswt.c: In function 'last_stats':
scaleswt.c:1230:67: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
1230 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate rs_s: %ld\n",__FILE__, __LINE__,sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS tatstats.c -o tatstats_fs.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTS -c dropfs2.c -o drop_fs2.o
dropfs2.c: In function 'init_work':
dropfs2.c:377:61: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
| ~~^
| |
| long int
| %d
378 | tat_size * sizeof(struct tat_str *));
| ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTS -c cal_consf.c -o calcons_fs.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTX initfa.c -o init_fx.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c faatran.c
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropfx2.c -o drop_fx.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTX -DTFAST initfa.c -o init_tfx.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST dropfx2.c -o drop_tfx.o
dropfx2.c: In function 'do_walign':
dropfx2.c:2660:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
2660 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
2661 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
dropfx2.c: In function 'do_walign':
dropfx2.c:2660:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
2660 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
2661 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTY initfa.c -o init_fy.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropfz3.c -o drop_fz.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTY -DTFAST initfa.c -o init_tfy.o
dropfz3.c: In function 'init_work':
dropfz3.c:629:79: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
629 | fprintf (stderr,"*** ERROR [%s:%d] - cannot allocate diagonal arrays: %lu\n",
| ~~^
| |
| long unsigned int
| %u
dropfz3.c: In function 'do_walign':
dropfz3.c:2672:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
2672 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
2673 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST dropfz3.c -o drop_tfz.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS -DTFAST initfa.c -o init_tfs.o
dropfz3.c: In function 'init_work':
dropfz3.c:629:79: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
629 | fprintf (stderr,"*** ERROR [%s:%d] - cannot allocate diagonal arrays: %lu\n",
| ~~^
| |
| long unsigned int
| %u
dropfz3.c: In function 'do_walign':
dropfz3.c:2672:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
2672 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
2673 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST -DFASTS dropfs2.c -o drop_tfs.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTS -c cal_consf.c -o calcons_tfs.o
dropfs2.c: In function 'init_work':
dropfs2.c:377:61: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
| ~~^
| |
| long int
| %d
378 | tat_size * sizeof(struct tat_str *));
| ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM initfa.c -o init_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM tatstats.c -o tatstats_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM dropfs2.c -o drop_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTM -c cal_consf.c -o calcons_fm.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
dropfs2.c: In function 'init_work':
dropfs2.c:377:61: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
| ~~^
| |
| long int
| %d
378 | tat_size * sizeof(struct tat_str *));
| ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mshowalign2.c -o mshowalign2_s.o
mshowalign2.c: In function 'showalign':
mshowalign2.c:617:64: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
mshowalign2.c:617:68: warning: format '%lu' expects argument of type 'long unsigned int', but argument 6 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM -DTFAST initfa.c -o init_tfm.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST -DFASTM dropfs2.c -o drop_tfm.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTM -c cal_consf.c -o calcons_tfm.o
dropfs2.c: In function 'init_work':
dropfs2.c:377:61: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
| ~~^
| |
| long int
| %d
378 | tat_size * sizeof(struct tat_str *));
| ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF initfa.c -o init_ff.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTF -c scaleswt.c -o scaleswtf.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
scaleswt.c: In function 'process_hist':
scaleswt.c:184:72: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
184 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate rs_snion: %ld\n",__FILE__, __LINE__, sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
scaleswt.c: In function 'last_stats':
scaleswt.c:1230:67: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
1230 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate rs_s: %ld\n",__FILE__, __LINE__,sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF tatstats.c -o tatstats_ff.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF dropff2.c -o drop_ff2.o
dropff2.c: In function 'init_work':
dropff2.c:120:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
120 | fprintf(stderr, "*** ERROR [%s:%d] - cannot calloc f_str [%lu]\n",
| ~~^
| |
| long unsigned int
| %u
121 | __FILE__, __LINE__, sizeof(struct f_struct));
| ~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
dropff2.c: In function 'do_walign':
dropff2.c:1176:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
1176 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
1177 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTF -c cal_consf.c -o calcons_ff.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF -DTFAST initfa.c -o init_tf.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF -DTFAST dropff2.c -o drop_tff.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTF -c cal_consf.c -o calcons_tff.o
dropff2.c: In function 'init_work':
dropff2.c:120:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
120 | fprintf(stderr, "*** ERROR [%s:%d] - cannot calloc f_str [%lu]\n",
| ~~^
| |
| long unsigned int
| %u
121 | __FILE__, __LINE__, sizeof(struct f_struct));
| ~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DNORMAL_DIST -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c scaleswn.c -o scale_sn.o
dropff2.c: In function 'do_walign':
dropff2.c:1176:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
1176 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
1177 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
scaleswn.c: In function 'process_hist':
scaleswn.c:255:55: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
255 | fprintf(stderr," cannot allocate pstat_union: %ld\n",sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| | unsigned int
| long int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DGLSEARCH initfa.c -o init_lnw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DSW_SSE2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnnw2.c -o droplnw_sse.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c glocal_sse2.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DGGSEARCH -c wm_align.c -o gwm_align.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DGGSEARCH initfa.c -o init_gnw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DGLOBAL_GLOBAL -DSW_SSE2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnnw2.c -o dropgnw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c global_sse2.c
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:68: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -o ../bin/map_db map_db.c
map_db.c: In function 'main':
map_db.c:149:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
149 | fgets(lname,sizeof(lname),stdin);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
map_db.c: In function 'gbf_get_ent':
map_db.c:512:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
512 | fgets(lline,MAXLINE,libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~
map_db.c: In function 'src_int4_read':
map_db.c:524:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
524 | fread((char *)&b[0],(size_t)1,(size_t)4,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -o ../bin/fasta36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fa.o drop_nfa.o wm_align.o calcons_fa.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread
cc -o ../bin/ssearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_sw_sse.o dropgsw2_sse.o smith_waterman_sse2.o lwm_align.o calcons_sw.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/lalign36 comp_mlib9.o compacc2_s.o showbest.o build_ares.o re_getlib.o lshowalign.o htime.o apam.o doinit.o init_lal.o droplal2_sse.o smith_waterman_sse2.o lsim4.o calcons_la.o scale_se.o karlin.o last_thresh.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
cc -o ../bin/fasts36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fs.o drop_fs2.o calcons_fs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
initfa.c: In function 'get_lambda.constprop':
initfa.c:2225:54: warning: argument 1 value '3294967297' exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2225 | if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
| ^
/usr/include/stdlib.h:556:14: note: in a call to allocation function 'calloc' declared here
556 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
initfa.c: In function 'get_lambda.constprop':
initfa.c:2225:54: warning: argument 1 value '3294967297' exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2225 | if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
| ^
/usr/include/stdlib.h:556:14: note: in a call to allocation function 'calloc' declared here
556 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
cc -o ../bin/fastx36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fx.o drop_fx.o faatran.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/tfastx36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfx.o drop_tfx.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/fasty36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fy.o drop_fz.o faatran.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/tfasty36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfy.o drop_tfz.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/tfasts36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfs.o drop_tfs.o calcons_tfs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/fastm36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fm.o drop_fm.o calcons_fm.o scaleswts.o last_tat.o tatstats_fm.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/tfastm36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_s.o htime.o apam.o doinit.o init_tfm.o drop_tfm.o calcons_tfm.o scaleswts.o tatstats_fm.o last_tat.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowalign2.c:85:1: warning: type of 'buf_align_seq' does not match original declaration [-Wlto-type-mismatch]
85 | buf_align_seq(unsigned char **aa0, int n0,
| ^
compacc2e.c:3597:1: note: type mismatch in parameter 8
3597 | buf_align_seq(unsigned char **aa0, int n0,
| ^
compacc2e.c:3597:1: note: 'buf_align_seq' was previously declared here
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/fastf36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_ff.o drop_ff2.o calcons_ff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/tfastf36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tf.o drop_tff.o calcons_tff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/glsearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_lnw_sse.o droplnw_sse.o glocal_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
cc -o ../bin/ggsearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_gnw_sse.o dropgnw_sse.o global_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: 're_openlib' was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:62:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:84:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: 'get_annot' was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the '-flto' option documentation for more information
initfa.c: In function 'get_lambda.constprop':
initfa.c:2225:54: warning: argument 1 value '3294967297' exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2225 | if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
| ^
/usr/include/stdlib.h:556:14: note: in a call to allocation function 'calloc' declared here
556 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
initfa.c: In function 'get_lambda.constprop':
initfa.c:2225:54: warning: argument 1 value '3294967297' exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2225 | if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
| ^
/usr/include/stdlib.h:556:14: note: in a call to allocation function 'calloc' declared here
556 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
make[2]: Leaving directory '/<<PKGBUILDDIR>>/src'
# convoluted, but necessary to allow cross builds
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_auto_test
make[1]: Entering directory '/<<PKGBUILDDIR>>'
cd test ; ./test2G.sh && ./test.sh && ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg
STARTING FASTA36 Wed Dec 28 07:08:31 UTC 2022 on bm-wb-02
Linux bm-wb-02 4.9.0-0.bpo.6-armmp #1 SMP Debian 4.9.82-1+deb9u3~bpo8+1 (2018-03-22) armv7l GNU/Linux
starting prss36(ssearch/fastx) Wed Dec 28 07:08:31 UTC 2022
done
starting lalign36 Wed Dec 28 07:08:34 UTC 2022
FINISHED Wed Dec 28 07:21:49 UTC 2022
STARTING FASTA36 Wed Dec 28 07:21:49 UTC 2022 on bm-wb-02
Linux bm-wb-02 4.9.0-0.bpo.6-armmp #1 SMP Debian 4.9.82-1+deb9u3~bpo8+1 (2018-03-22) armv7l GNU/Linux
starting prss36(ssearch/fastx) Wed Dec 28 07:21:49 UTC 2022
done
starting lalign36 Wed Dec 28 07:21:51 UTC 2022
FINISHED Wed Dec 28 07:35:07 UTC 2022
# ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg
FASTA searches a protein or DNA sequence data bank
version 36.3.8i Nov, 2022
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: ../seq/mgstm1.aa
1>>>sp|P10649|GSTM1_MOUSE Glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; Glutathione S-transferase GT8.7; pmGT10 - 218 aa
Library: ../seq/prot_test.lseg
2267 residues in 12 sequences
Statistics: (shuffled [481]) MLE statistics: Lambda= 0.1704; K=0.005652
statistics sampled from 4 (4) to 481 sequences
Algorithm: FASTA (3.8 Nov 2011) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.667), E-opt: 0.2 (0.333), width: 16
Scan time: 0.050
The best scores are: opt bits E(12)
sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu ( 218) 1242 314.8 9.7e-90
sp|P00502|GSTA1_RAT Glutathione S-transferase alph ( 222) 237 67.7 2.4e-15
sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Ho ( 142) 51 22.0 0.091
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinas ( 351) 43 20.0 0.85
sp|P14960|RBS_GUITH Ribulose bisphosphate carboxyl ( 139) 36 18.3 1.1
sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG ( 108) 31 17.0 1.9
sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodyte ( 105) 30 16.8 2.2
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle ( 160) 30 16.8 3.2
sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A ( 567) 37 18.5 3.4
sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A ( 95) 26 15.8 3.6
sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococc ( 54) 22 14.8 4
sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Ho ( 106) 23 15.1 5.9
>>sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 O (218 aa)
initn: 1242 init1: 1242 opt: 1242 Z-score: 1662.9 bits: 314.8 E(12): 9.7e-90
Smith-Waterman score: 1242; 78.0% identity (95.4% similar) in 218 aa overlap (1-218:1-218)
10 20 30 40 50 60
sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL
::::::::..:::.: ::.:::::::::.::.::::::::.:::::::::::::::::::
sp|P09 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
10 20 30 40 50 60
70 80 90 100 110 120
sp|P10 PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF
::::::.:::::::::: :.::::.: ::::::.::.::.:::.::..::: :.::::.:
sp|P09 PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
70 80 90 100 110 120
130 140 150 160 170 180
sp|P10 EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN
:: ::..:. .:::.:::::::::::::::.:.:.::::.::.:: .:.:::::::::::
sp|P09 EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
130 140 150 160 170 180
190 200 210
sp|P10 LRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
:.::..:::::.::::::::::.. :.::::: :.::
sp|P09 LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
190 200 210
>>sp|P00502|GSTA1_RAT Glutathione S-transferase alpha-1 (222 aa)
initn: 204 init1: 73 opt: 237 Z-score: 327.2 bits: 67.7 E(12): 2.4e-15
Smith-Waterman score: 237; 27.4% identity (57.0% similar) in 223 aa overlap (4-218:6-218)
10 20 30 40 50
sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKL--GLD
.: :.:.:: . :: :: . .::: : .: ::.: .:
sp|P00 MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEK---------FIQSPEDLEKLKKDGNLM
10 20 30 40 50
60 70 80 90 100 110
sp|P10 FPNLPYL-IDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMD-TRMQLIML
: ..:.. ::: :..:. ::: :.: :. : :. .:: :. . ..: :.: . ..
sp|P00 FDQVPMVEIDG-MKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLV
60 70 80 90 100 110
120 130 140 150 160 170
sp|P10 CYNPDFEKQKPEFLK--TIPEKMKLYSEFLGK--RPWFAGDKVTYVDFLAYDILDQYRMF
:: .. : . : : . . . . : . . ...:...: ::. ..: . :
sp|P00 ICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEF
120 130 140 150 160 170
180 190 200 210
sp|P10 EPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
. . : .:: :. : .:. .: ... ... . :. .:. . . :
sp|P00 DASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
180 190 200 210 220
>>sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo s (142 aa)
initn: 40 init1: 40 opt: 51 Z-score: 83.5 bits: 22.0 E(12): 0.091
Smith-Waterman score: 51; 25.6% identity (69.2% similar) in 39 aa overlap (177-214:36-73)
150 160 170 180 190 200
sp|P10 WFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS-SRYIA
.::. . .. .:. :.. :: .:. .. .:
sp|P69 ADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFD-LSHGSAQVKGHGKKVA
10 20 30 40 50 60
210
sp|P10 TPIFSKMAHWSNK
. . .::
sp|P69 DALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHA
70 80 90 100 110 120
>>sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase ca (351 aa)
initn: 43 init1: 43 opt: 43 Z-score: 65.8 bits: 20.0 E(12): 0.85
Smith-Waterman score: 54; 23.6% identity (47.2% similar) in 72 aa overlap (137-206:229-300)
110 120 130 140 150 160
sp|P10 TRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQ
.: : :.:: . . . .. .
sp|P00 LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRF
200 210 220 230 240 250
170 180 190 200 210
sp|P10 YRMFEPKCLDAFPNLR--DFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
: : . :: :. :: .::. .:. ...::
sp|P00 PSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPK
260 270 280 290 300 310
sp|P00 FKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
320 330 340 350
>>sp|P14960|RBS_GUITH Ribulose bisphosphate carboxylase (139 aa)
initn: 56 init1: 36 opt: 36 Z-score: 63.8 bits: 18.3 E(12): 1.1
Smith-Waterman score: 36; 57.1% identity (85.7% similar) in 7 aa overlap (7-13:47-53)
10 20 30
sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMG
::.. ::
sp|P14 EQIVKQIQYAISKNWALNVEWTDDPHPRNAYWDLWGLPLFGIKDPAAVMFEINACRKAKP
20 30 40 50 60 70
40 50 60 70 80 90
sp|P10 DAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIR
sp|P14 ACYVKVNAFDNSRGVESCCLSFIVQRPTSNEPGFQLIRSEVDSRNIRYTIQSYASTRPEG
80 90 100 110 120 130
>>sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS= (108 aa)
initn: 31 init1: 31 opt: 31 Z-score: 59.1 bits: 17.0 E(12): 1.9
Smith-Waterman score: 33; 36.0% identity (54.0% similar) in 50 aa overlap (150-190:16-64)
120 130 140 150 160 170
sp|P10 FEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDI---LDQYRMFE---PK
::.:: . . :: :. :.. ::
sp|P01 DIQMTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPK
10 20 30 40
180 190 200 210
sp|P10 CL--DAFPNLRDFL-ARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
: :: ::. . .:: :
sp|P01 ILIYDA-SNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKL
50 60 70 80 90 100
>>sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodytes GN (105 aa)
initn: 30 init1: 30 opt: 30 Z-score: 58.0 bits: 16.8 E(12): 2.2
Smith-Waterman score: 36; 26.5% identity (54.4% similar) in 68 aa overlap (129-193:28-88)
100 110 120 130 140 150
sp|P10 IVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWF---AGDKVTY
:: :. :... :. : . :..:
sp|P99 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKG
10 20 30 40 50
160 170 180 190 200 210
sp|P10 VDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHW
. . . : : .: . .:: .:. . . : :.::
sp|P99 I-IWGEDTLMEY-LENPK--KYIPGTKMI---FVGIKKKEERADLIAYLKKATNE
60 70 80 90 100
sp|P10 SNK
>>sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=H (160 aa)
initn: 30 init1: 30 opt: 30 Z-score: 54.7 bits: 16.8 E(12): 3.2
Smith-Waterman score: 41; 25.9% identity (63.0% similar) in 54 aa overlap (44-92:13-62)
20 30 40 50 60 70
sp|P10 THPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--
:. . .:: ..:. . ::. :.
sp|P02 MTDQQAEARSYLSEEMIAEFKAAFDM----FDADGGGDISVK
10 20 30
80 90 100 110 120
sp|P10 QSNAILRYLAR---KHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFL
. ....:.:.. :..::. ::
sp|P02 ELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAE
40 50 60 70 80 90
>>sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A viru (567 aa)
initn: 37 init1: 37 opt: 37 Z-score: 54.1 bits: 18.5 E(12): 3.4
Smith-Waterman score: 50; 28.2% identity (64.1% similar) in 39 aa overlap (74-111:399-437)
50 60 70 80 90 100
sp|P10 SQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARK-HHLDGETEEERIRADIVEN
: ... .: :... : : . : . .:.
sp|P03 GFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEK
370 380 390 400 410 420
110 120 130 140 150 160
sp|P10 QVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYD
: ::...:
sp|P03 YVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYH
430 440 450 460 470 480
>>sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A31 O (95 aa)
initn: 26 init1: 26 opt: 26 Z-score: 53.4 bits: 15.8 E(12): 3.6
Smith-Waterman score: 30; 54.5% identity (63.6% similar) in 11 aa overlap (115-125:86-94)
90 100 110 120 130 140
sp|P10 HLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGK
: :: ::.:
sp|P60 SRGKVVELGCAATCPSKKPYEEVTCCSTDKC-NPH-PKQRPG
60 70 80 90
150 160 170 180 190 200
sp|P10 RPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYI
>>sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococcus a (54 aa)
initn: 22 init1: 22 opt: 22 Z-score: 52.5 bits: 14.8 E(12): 4
Smith-Waterman score: 25; 50.0% identity (100.0% similar) in 4 aa overlap (171-174:15-18)
150 160 170 180 190 200
sp|P10 FLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS
.:.:
sp|P00 AYVINDSCIACGACKPECPVNIQQGSIYAIDADSCIDCGSCASV
10 20 30 40
210
sp|P10 SRYIATPIFSKMAHWSNK
sp|P00 CPVGAPNPED
50
>>sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Homo s (106 aa)
initn: 23 init1: 23 opt: 23 Z-score: 48.6 bits: 15.1 E(12): 5.9
Smith-Waterman score: 35; 18.3% identity (53.5% similar) in 71 aa overlap (58-124:12-82)
30 40 50 60 70 80
sp|P10 YDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--QSNAILRYLARKHH
:. : .:. ... .: : . .
sp|P01 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK
10 20 30 40
90 100 110 120 130 140
sp|P10 LDGETEEERIRADIVENQVMDTRMQL--IMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLG
.:. . . ...:.. :. ..: . . :.::.:
sp|P01 VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
50 60 70 80 90 100
150 160 170 180 190 200
sp|P10 KRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRY
sp|P01 NRGEC
218 residues in 1 query sequences
2267 residues in 12 library sequences
Tcomplib [36.3.8i Nov, 2022] (4 proc in memory [0G])
start: Wed Dec 28 07:35:07 2022 done: Wed Dec 28 07:35:07 2022
Total Scan time: 0.050 Total Display time: 0.040
Function used was FASTA [36.3.8i Nov, 2022]
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
create-stamp debian/debhelper-build-stamp
dh_testroot -a -O--sourcedirectory=src
dh_prep -a -O--sourcedirectory=src
dh_auto_install -a -O--sourcedirectory=src
dh_install -a -O--sourcedirectory=src
dh_installdocs -a -O--sourcedirectory=src
dh_installchangelogs -a -O--sourcedirectory=src
dh_installexamples -a -O--sourcedirectory=src
dh_installman -a -O--sourcedirectory=src
dh_installsystemduser -a -O--sourcedirectory=src
dh_perl -a -O--sourcedirectory=src
dh_link -a -O--sourcedirectory=src
dh_strip_nondeterminism -a -O--sourcedirectory=src
debian/rules override_dh_compress
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_compress --exclude=.pdf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
dh_fixperms -a -O--sourcedirectory=src
dh_missing -a -O--sourcedirectory=src
dh_dwz -a -O--sourcedirectory=src
dh_strip -a -O--sourcedirectory=src
dh_makeshlibs -a -O--sourcedirectory=src
dh_shlibdeps -a -O--sourcedirectory=src
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/fasta3/usr/bin/fasts36 debian/fasta3/usr/bin/tfastm36 debian/fasta3/usr/bin/tfasts36 debian/fasta3/usr/bin/tfastx36 debian/fasta3/usr/bin/tfasty36 debian/fasta3/usr/bin/map_db debian/fasta3/usr/bin/fastf36 debian/fasta3/usr/bin/ssearch36 debian/fasta3/usr/bin/fasta36 debian/fasta3/usr/bin/fastx36 debian/fasta3/usr/bin/lalign36 debian/fasta3/usr/bin/glsearch36 debian/fasta3/usr/bin/fasty36 debian/fasta3/usr/bin/tfastf36 debian/fasta3/usr/bin/fastm36 debian/fasta3/usr/bin/ggsearch36 were not linked against ld-linux-armhf.so.3 (they use none of the library's symbols)
dh_installdeb -a -O--sourcedirectory=src
dh_gencontrol -a -O--sourcedirectory=src
dh_md5sums -a -O--sourcedirectory=src
dh_builddeb -a -O--sourcedirectory=src
dpkg-deb: building package 'fasta3-dbgsym' in '../fasta3-dbgsym_36.3.8i.14-Nov-2020-1_armhf.deb'.
dpkg-deb: building package 'fasta3' in '../fasta3_36.3.8i.14-Nov-2020-1_armhf.deb'.
dpkg-genbuildinfo --build=any -O../fasta3_36.3.8i.14-Nov-2020-1_armhf.buildinfo
dpkg-genchanges --build=any -mRaspbian wandboard test autobuilder <root@raspbian.org> -O../fasta3_36.3.8i.14-Nov-2020-1_armhf.changes
dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included)
dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
--------------------------------------------------------------------------------
Build finished at 2022-12-28T07:36:24Z
Finished
--------
I: Built successfully
+------------------------------------------------------------------------------+
| Post Build Chroot |
+------------------------------------------------------------------------------+
+------------------------------------------------------------------------------+
| Changes |
+------------------------------------------------------------------------------+
fasta3_36.3.8i.14-Nov-2020-1_armhf.changes:
-------------------------------------------
Format: 1.8
Date: Sun, 25 Dec 2022 19:00:56 +0100
Source: fasta3
Binary: fasta3 fasta3-dbgsym
Architecture: armhf
Version: 36.3.8i.14-Nov-2020-1
Distribution: bookworm-staging
Urgency: medium
Maintainer: Raspbian wandboard test autobuilder <root@raspbian.org>
Changed-By: Andreas Tille <tille@debian.org>
Description:
fasta3 - tools for searching collections of biological sequences
Changes:
fasta3 (36.3.8i.14-Nov-2020-1) unstable; urgency=medium
.
* Team upload.
* New upstream version
* Standards-Version: 4.6.2 (routine-update)
* Recommends: r-base-core
Checksums-Sha1:
fcc4dc9613df19673084ae4fd613a833708596fc 5159272 fasta3-dbgsym_36.3.8i.14-Nov-2020-1_armhf.deb
17edea06645c69407a2f0918a45ba27f8148cf7d 5077 fasta3_36.3.8i.14-Nov-2020-1_armhf.buildinfo
8208e76ba15d0bdd4e67685cb152e003bba93910 728348 fasta3_36.3.8i.14-Nov-2020-1_armhf.deb
Checksums-Sha256:
bf593f6635f9aecac4d54e5473edfa0d33bbaa45d7af8a60dfcaef928417a331 5159272 fasta3-dbgsym_36.3.8i.14-Nov-2020-1_armhf.deb
5368f5cfd6724938b51ad0633826a9e992ea504cb2f7f55c897909a01866c1b1 5077 fasta3_36.3.8i.14-Nov-2020-1_armhf.buildinfo
5cc684d212a48f3111117e82453e0d2a68abd7514add8b7c83602eb83d3eacc0 728348 fasta3_36.3.8i.14-Nov-2020-1_armhf.deb
Files:
06fa1e67ab57db8d58221390d8fc32fd 5159272 debug optional fasta3-dbgsym_36.3.8i.14-Nov-2020-1_armhf.deb
b08534d03e1597e7b161ad3273594957 5077 science optional fasta3_36.3.8i.14-Nov-2020-1_armhf.buildinfo
396444b47e94bd5867cb30f73d3ba650 728348 science optional fasta3_36.3.8i.14-Nov-2020-1_armhf.deb
+------------------------------------------------------------------------------+
| Package contents |
+------------------------------------------------------------------------------+
fasta3-dbgsym_36.3.8i.14-Nov-2020-1_armhf.deb
---------------------------------------------
new Debian package, version 2.0.
size 5159272 bytes: control archive=1336 bytes.
1010 bytes, 12 lines control
1782 bytes, 17 lines md5sums
Package: fasta3-dbgsym
Source: fasta3
Version: 36.3.8i.14-Nov-2020-1
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 5677
Depends: fasta3 (= 36.3.8i.14-Nov-2020-1)
Section: debug
Priority: optional
Description: debug symbols for fasta3
Build-Ids: 02df8f096808eb6c234e6822403fbf1127a11501 0588b71f3e6b23f3bbc68124151058ec765a9fc3 3fdc3f550ca3b3be266282bc8123f55de9095b82 4da94ee18b494849625c414fdba325ea721a60df 4dabfd5f69af18c8975c74a2de972b778c12370e 62da110c1055b6d99de019631b87d48ffdafee3e 7213349506ef4eab975704cd221844941ad81eb0 7b5c697bf122f6fdd9712578dc43a19720bebc86 7e583f27f0aac0b29286a41389af8deb9334b5ca 8705fbbb93824d584cebbe91e61e3f7f59020cfc 91b8d7f1732e93264405a0325845c804a82ea9f6 9774c8ee6b9deb8b59876ffbd1d8738ed20c53f8 da31b4b6ed7475b9ad99a3cfbb9015a805fac804 f341bb9cf816e457ed2ef6db42a2ca49095c8c83 f6f1d96e7fa64dc7cd8a6cf63257ad613ce4c8e1 fbb062b843937b925637efcad8187587b40804bd
drwxr-xr-x root/root 0 2022-12-25 18:00 ./
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/02/
-rw-r--r-- root/root 15596 2022-12-25 18:00 ./usr/lib/debug/.build-id/02/df8f096808eb6c234e6822403fbf1127a11501.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/05/
-rw-r--r-- root/root 431084 2022-12-25 18:00 ./usr/lib/debug/.build-id/05/88b71f3e6b23f3bbc68124151058ec765a9fc3.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/3f/
-rw-r--r-- root/root 419796 2022-12-25 18:00 ./usr/lib/debug/.build-id/3f/dc3f550ca3b3be266282bc8123f55de9095b82.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/4d/
-rw-r--r-- root/root 433572 2022-12-25 18:00 ./usr/lib/debug/.build-id/4d/a94ee18b494849625c414fdba325ea721a60df.debug
-rw-r--r-- root/root 338868 2022-12-25 18:00 ./usr/lib/debug/.build-id/4d/abfd5f69af18c8975c74a2de972b778c12370e.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/62/
-rw-r--r-- root/root 392584 2022-12-25 18:00 ./usr/lib/debug/.build-id/62/da110c1055b6d99de019631b87d48ffdafee3e.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/72/
-rw-r--r-- root/root 394200 2022-12-25 18:00 ./usr/lib/debug/.build-id/72/13349506ef4eab975704cd221844941ad81eb0.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/7b/
-rw-r--r-- root/root 383728 2022-12-25 18:00 ./usr/lib/debug/.build-id/7b/5c697bf122f6fdd9712578dc43a19720bebc86.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/7e/
-rw-r--r-- root/root 341764 2022-12-25 18:00 ./usr/lib/debug/.build-id/7e/583f27f0aac0b29286a41389af8deb9334b5ca.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/87/
-rw-r--r-- root/root 387692 2022-12-25 18:00 ./usr/lib/debug/.build-id/87/05fbbb93824d584cebbe91e61e3f7f59020cfc.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/91/
-rw-r--r-- root/root 335820 2022-12-25 18:00 ./usr/lib/debug/.build-id/91/b8d7f1732e93264405a0325845c804a82ea9f6.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/97/
-rw-r--r-- root/root 342140 2022-12-25 18:00 ./usr/lib/debug/.build-id/97/74c8ee6b9deb8b59876ffbd1d8738ed20c53f8.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/da/
-rw-r--r-- root/root 387804 2022-12-25 18:00 ./usr/lib/debug/.build-id/da/31b4b6ed7475b9ad99a3cfbb9015a805fac804.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/f3/
-rw-r--r-- root/root 339500 2022-12-25 18:00 ./usr/lib/debug/.build-id/f3/41bb9cf816e457ed2ef6db42a2ca49095c8c83.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/f6/
-rw-r--r-- root/root 338600 2022-12-25 18:00 ./usr/lib/debug/.build-id/f6/f1d96e7fa64dc7cd8a6cf63257ad613ce4c8e1.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.build-id/fb/
-rw-r--r-- root/root 417768 2022-12-25 18:00 ./usr/lib/debug/.build-id/fb/b062b843937b925637efcad8187587b40804bd.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.dwz/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/lib/debug/.dwz/arm-linux-gnueabihf/
-rw-r--r-- root/root 80312 2022-12-25 18:00 ./usr/lib/debug/.dwz/arm-linux-gnueabihf/fasta3.debug
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/doc/
lrwxrwxrwx root/root 0 2022-12-25 18:00 ./usr/share/doc/fasta3-dbgsym -> fasta3
fasta3_36.3.8i.14-Nov-2020-1_armhf.deb
--------------------------------------
new Debian package, version 2.0.
size 728348 bytes: control archive=5920 bytes.
2177 bytes, 54 lines control
13915 bytes, 188 lines md5sums
Package: fasta3
Version: 36.3.8i.14-Nov-2020-1
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 6282
Depends: libc6 (>= 2.34), python3
Recommends: r-base-core
Suggests: perl:any, libdbi-perl, libwww-perl, libjson-perl, libhtml-tableextract-perl, libxml-twig-perl, liburi-encode-perl, libdbd-mysql-perl, python3-mysqldb, ncbi-blast+, bedtools
Section: science
Priority: optional
Homepage: https://fasta.bioch.virginia.edu
Description: tools for searching collections of biological sequences
The FASTA programs find regions of local or global similarity between
Protein or DNA sequences, either by searching Protein or DNA databases,
or by identifying local duplications within a sequence. Other
programs provide information on the statistical significance of an
alignment. Like BLAST, FASTA can be used to infer functional and
evolutionary relationships between sequences as well as help identify
members of gene families.
.
* Protein
- Protein-protein FASTA
- Protein-protein Smith-Waterman (ssearch)
- Global Protein-protein (Needleman-Wunsch) (ggsearch)
- Global/Local protein-protein (glsearch)
- Protein-protein with unordered peptides (fasts)
- Protein-protein with mixed peptide sequences (fastf)
.
* Nucleotide
- Nucleotide-Nucleotide (DNA/RNA fasta)
- Ordered Nucleotides vs Nucleotide (fastm)
- Un-ordered Nucleotides vs Nucleotide (fasts)
.
* Translated
- Translated DNA (with frameshifts, e.g. ESTs)
vs Proteins (fastx/fasty)
- Protein vs Translated DNA (with frameshifts)
(tfastx/tfasty)
- Peptides vs Translated DNA (tfasts)
.
* Statistical Significance
- Protein vs Protein shuffle (prss)
- DNA vs DNA shuffle (prss)
- Translated DNA vs Protein shuffle (prfx)
.
* Local Duplications
- Local Protein alignments (lalign)
- Plot Protein alignment "dot-plot" (plalign)
- Local DNA alignments (lalign)
- Plot DNA alignment "dot-plot" (plalign)
.
This software is often used via a web service at the
EBI with readily indexed reference databases at
http://www.ebi.ac.uk/Tools/fasta/.
drwxr-xr-x root/root 0 2022-12-25 18:00 ./
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/bin/
-rwxr-xr-x root/root 375048 2022-12-25 18:00 ./usr/bin/fasta36
-rwxr-xr-x root/root 303896 2022-12-25 18:00 ./usr/bin/fastf36
-rwxr-xr-x root/root 303836 2022-12-25 18:00 ./usr/bin/fastm36
-rwxr-xr-x root/root 303836 2022-12-25 18:00 ./usr/bin/fasts36
-rwxr-xr-x root/root 375120 2022-12-25 18:00 ./usr/bin/fastx36
-rwxr-xr-x root/root 375120 2022-12-25 18:00 ./usr/bin/fasty36
-rwxr-xr-x root/root 374896 2022-12-25 18:00 ./usr/bin/ggsearch36
-rwxr-xr-x root/root 374896 2022-12-25 18:00 ./usr/bin/glsearch36
-rwxr-xr-x root/root 374896 2022-12-25 18:00 ./usr/bin/lalign36
-rwxr-xr-x root/root 67160 2022-12-25 18:00 ./usr/bin/map_db
-rwxr-xr-x root/root 375016 2022-12-25 18:00 ./usr/bin/ssearch36
-rwxr-xr-x root/root 304160 2022-12-25 18:00 ./usr/bin/tfastf36
-rwxr-xr-x root/root 304108 2022-12-25 18:00 ./usr/bin/tfastm36
-rwxr-xr-x root/root 304108 2022-12-25 18:00 ./usr/bin/tfasts36
-rwxr-xr-x root/root 375120 2022-12-25 18:00 ./usr/bin/tfastx36
-rwxr-xr-x root/root 375120 2022-12-25 18:00 ./usr/bin/tfasty36
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/doc/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/doc/fasta3/
-rw-r--r-- root/root 1181 2022-12-25 18:00 ./usr/share/doc/fasta3/changelog.Debian.gz
-rw-r--r-- root/root 2874 2022-12-25 18:00 ./usr/share/doc/fasta3/copyright
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/doc/fasta3/examples/
drwxr-xr-x root/root 0 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/
-rw-r--r-- root/root 2528 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/bovgh.seq
-rw-r--r-- root/root 986 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/bovprl.seq
-rw-r--r-- root/root 3159 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/dna_test_s.nlib
-rw-r--r-- root/root 261 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/dyr_human.aa
-rw-r--r-- root/root 1286 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/egmsmg.aa
-rw-r--r-- root/root 806 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/grou_drome.pseg
-rw-r--r-- root/root 18633 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gst.nlib
-rw-r--r-- root/root 1405 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gst.seq
-rw-r--r-- root/root 309 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstm1_human.vaa
-rw-r--r-- root/root 1226 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstm1b_human.nt
-rw-r--r-- root/root 1226 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstm1b_human_fs.nt
-rw-r--r-- root/root 304 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstt1_drome.aa
-rw-r--r-- root/root 311 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gtm1_human.aa
-rw-r--r-- root/root 291 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gtt1_drome.aa
-rw-r--r-- root/root 247 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/h10_human.aa
-rw-r--r-- root/root 225 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/hahu.aa
-rw-r--r-- root/root 7118 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.gcg
-rw-r--r-- root/root 2788 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.seq
-rw-r--r-- root/root 1323 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/humgstd.seq
-rw-r--r-- root/root 271 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/lcbo.aa
-rw-r--r-- root/root 56 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/m1r.aa
-rw-r--r-- root/root 50 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/m2.aa
-rw-r--r-- root/root 189 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mchu.aa
-rw-r--r-- root/root 3440 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.3nt
-rw-r--r-- root/root 342 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.aa
-rw-r--r-- root/root 310 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.aaa
-rw-r--r-- root/root 1220 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.e05
-rw-r--r-- root/root 1122 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.eeq
-rw-r--r-- root/root 1116 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.esq
-rw-r--r-- root/root 406 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.gcg
-rw-r--r-- root/root 282 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.lc
-rw-r--r-- root/root 677 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt
-rw-r--r-- root/root 682 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1
-rw-r--r-- root/root 1352 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt12r
-rw-r--r-- root/root 2033 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13
-rw-r--r-- root/root 2028 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13r
-rw-r--r-- root/root 681 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1r
-rw-r--r-- root/root 160 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nts
-rw-r--r-- root/root 259 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.raa
-rw-r--r-- root/root 1167 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.rev
-rw-r--r-- root/root 1158 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.seq
-rw-r--r-- root/root 148692 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1_genclone.seq
-rw-r--r-- root/root 1286 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgtt2_x.seq
-rw-r--r-- root/root 43 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/ms1.aa
-rw-r--r-- root/root 2361 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mu.lib
-rw-r--r-- root/root 275 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/musplfm.aa
-rw-r--r-- root/root 2047 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mwkw.aa
-rw-r--r-- root/root 500 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mwrtc1.aa
-rw-r--r-- root/root 1294 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/myosin_bp.aa
-rw-r--r-- root/root 27 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n0.aa
-rw-r--r-- root/root 47 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n1.aa
-rw-r--r-- root/root 692 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2.aa
-rw-r--r-- root/root 1482 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2_fs.lib
-rw-r--r-- root/root 178 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2s.aa
-rw-r--r-- root/root 243 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2t.aa
-rw-r--r-- root/root 330 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n_fs.lib
-rw-r--r-- root/root 217 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/ngt.aa
-rw-r--r-- root/root 111 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/ngts.aa
-rw-r--r-- root/root 385 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/oohu.aa
-rw-r--r-- root/root 401 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/oohu.raa
-rw-r--r-- root/root 340 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prio_atepa.aa
-rw-r--r-- root/root 2741 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prot_test.lib
-rw-r--r-- root/root 3391 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prot_test.lseg
-rw-r--r-- root/root 1530 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prot_test_s.lseg
-rw-r--r-- root/root 914 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/qrhuld.aa
-rw-r--r-- root/root 34874 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/titin_hum.aa
-rw-r--r-- root/root 83286 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/titin_hum.seq
-rw-r--r-- root/root 934 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/vav_human.aa
-rw-r--r-- root/root 302 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/xurt8c.aa
-rw-r--r-- root/root 302 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/xurt8c.lc
-rw-r--r-- root/root 281 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/xurtg.aa
drwxr-xr-x root/root 0 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/
-rw-r--r-- root/root 992 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/README
-rw-r--r-- root/root 536 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/create_seq_demo.sql
-rwxr-xr-x root/root 3227 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/join_up50.pl
-rw-r--r-- root/root 347 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/mysql_demo1.sql
-rw-r--r-- root/root 388 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/mysql_demo_pv.sql
-rwxr-xr-x root/root 3300 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/nr_to_sql.pl
-rw-r--r-- root/root 230 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/pirpsd.sql
-rw-r--r-- root/root 317 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/psql_demo.sql
-rw-r--r-- root/root 373 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/psql_demo1.sql
-rw-r--r-- root/root 343 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/psql_demo_pv.sql
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/fasta3/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/fasta3/data/
-rw-r--r-- root/root 2764 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_10.mat
-rw-r--r-- root/root 2548 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_120.mat
-rw-r--r-- root/root 2548 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_160.mat
-rw-r--r-- root/root 2546 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_20.mat
-rw-r--r-- root/root 2548 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_200.mat
-rw-r--r-- root/root 2546 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_40.mat
-rw-r--r-- root/root 2545 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_80.mat
-rw-r--r-- root/root 1922 2022-11-14 21:42 ./usr/share/fasta3/data/blosum45.mat
-rw-r--r-- root/root 1921 2022-11-14 21:42 ./usr/share/fasta3/data/blosum50.mat
-rw-r--r-- root/root 1922 2022-11-14 21:42 ./usr/share/fasta3/data/blosum62.mat
-rw-r--r-- root/root 1924 2022-11-14 21:42 ./usr/share/fasta3/data/blosum80.mat
-rw-r--r-- root/root 976 2022-11-14 21:42 ./usr/share/fasta3/data/dna.mat
-rw-r--r-- root/root 2256 2022-11-14 21:42 ./usr/share/fasta3/data/idn_aa.mat
-rw-r--r-- root/root 2255 2022-11-14 21:42 ./usr/share/fasta3/data/md_10.mat
-rw-r--r-- root/root 2256 2022-11-14 21:42 ./usr/share/fasta3/data/md_20.mat
-rw-r--r-- root/root 2255 2022-11-14 21:42 ./usr/share/fasta3/data/md_40.mat
-rw-r--r-- root/root 1922 2022-11-14 21:42 ./usr/share/fasta3/data/pam120.mat
-rw-r--r-- root/root 1923 2022-11-14 21:42 ./usr/share/fasta3/data/pam250.mat
-rw-r--r-- root/root 998 2022-11-14 21:42 ./usr/share/fasta3/data/rna.mat
-rw-r--r-- root/root 2771 2022-11-14 21:42 ./usr/share/fasta3/data/vtml160.mat
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/fasta3/misc/
-rw-r--r-- root/root 424 2022-11-14 21:42 ./usr/share/fasta3/misc/README
-rwxr-xr-x root/root 3447 2022-11-14 21:42 ./usr/share/fasta3/misc/parse_m9.pl
-rwxr-xr-x root/root 367 2022-11-14 21:42 ./usr/share/fasta3/misc/res2R.pl
-rwxr-xr-x root/root 3177 2022-11-14 21:42 ./usr/share/fasta3/misc/shuffle_embed.pl
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/fasta3/scripts/
-rw-r--r-- root/root 5789 2022-11-14 21:42 ./usr/share/fasta3/scripts/README
-rw-r--r-- root/root 3182 2022-11-14 21:42 ./usr/share/fasta3/scripts/README.scripts
-rw-r--r-- root/root 76 2022-11-14 21:42 ./usr/share/fasta3/scripts/acc_examples
-rwxr-xr-x root/root 12539 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_exons_all.pl
-rwxr-xr-x root/root 7233 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_exons_ens.pl
-rwxr-xr-x root/root 4941 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_exons_ncbi.pl
-rwxr-xr-x root/root 8535 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_exons_up_sql.pl
-rwxr-xr-x root/root 12227 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_exons_up_sql_www.pl
-rwxr-xr-x root/root 9106 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_exons_up_www.pl
-rwxr-xr-x root/root 15933 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_feats2ipr.pl
-rwxr-xr-x root/root 15996 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_feats2ipr_e.pl
-rwxr-xr-x root/root 13524 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_feats_up_sql.pl
-rwxr-xr-x root/root 12846 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_feats_up_www2.pl
-rwxr-xr-x root/root 14551 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_ipr_www.pl
-rwxr-xr-x root/root 9521 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_pdb_cath.pl
-rwxr-xr-x root/root 8406 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_pdb_vast.pl
-rwxr-xr-x root/root 24113 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_pfam28.pl
-rwxr-xr-x root/root 27702 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_pfam30_tmptbl.pl
-rwxr-xr-x root/root 27278 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_pfam_sql.pl
-rwxr-xr-x root/root 8244 2022-11-14 21:42 ./usr/share/fasta3/scripts/ann_pfam_sql.py
-rwxr-xr-x root/root 20591 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_pfam_www.pl
-rwxr-xr-x root/root 7871 2022-11-14 21:42 ./usr/share/fasta3/scripts/ann_pfam_www.py
-rw-r--r-- root/root 321 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_script_list
-rwxr-xr-x root/root 23659 2022-12-25 18:00 ./usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl
-rwxr-xr-x root/root 44912 2022-12-25 18:00 ./usr/share/fasta3/scripts/annot_blast_btop2.pl
-rwxr-xr-x root/root 25321 2022-12-25 18:00 ./usr/share/fasta3/scripts/annot_blast_btop3.py
-rwxr-xr-x root/root 27067 2022-12-25 18:00 ./usr/share/fasta3/scripts/annot_blast_btop4.py
-rwxr-xr-x root/root 3017 2022-12-25 18:00 ./usr/share/fasta3/scripts/blastp_annot_cmd.sh
-rwxr-xr-x root/root 753 2022-12-25 18:00 ./usr/share/fasta3/scripts/blastp_cmd.sh
-rwxr-xr-x root/root 4583 2022-11-14 21:42 ./usr/share/fasta3/scripts/color_defs.pl
-rwxr-xr-x root/root 4564 2022-12-25 18:00 ./usr/share/fasta3/scripts/exp_up_ensg.pl
-rwxr-xr-x root/root 3275 2022-12-25 18:00 ./usr/share/fasta3/scripts/expand_links.pl
-rwxr-xr-x root/root 5572 2022-12-25 18:00 ./usr/share/fasta3/scripts/expand_refseq_isoforms.pl
-rwxr-xr-x root/root 2576 2022-12-25 18:00 ./usr/share/fasta3/scripts/expand_uniref50.pl
-rwxr-xr-x root/root 6043 2022-12-25 18:00 ./usr/share/fasta3/scripts/expand_up_isoforms.pl
-rwxr-xr-x root/root 1590 2022-12-25 18:00 ./usr/share/fasta3/scripts/fasta_annot_cmd.sh
-rwxr-xr-x root/root 1676 2022-12-25 18:00 ./usr/share/fasta3/scripts/get_genome_seq.py
-rwxr-xr-x root/root 1669 2022-12-25 18:00 ./usr/share/fasta3/scripts/get_protein.py
-rwxr-xr-x root/root 1722 2022-12-25 18:00 ./usr/share/fasta3/scripts/get_protein_sql.py
-rwxr-xr-x root/root 3659 2022-12-25 18:00 ./usr/share/fasta3/scripts/get_protein_sql_www.py
-rwxr-xr-x root/root 553 2022-12-25 18:00 ./usr/share/fasta3/scripts/get_refseq.py
-rwxr-xr-x root/root 409 2022-12-25 18:00 ./usr/share/fasta3/scripts/get_uniprot.py
-rwxr-xr-x root/root 1188 2022-12-25 18:00 ./usr/share/fasta3/scripts/get_up_prot_iso_sql.py
-rwxr-xr-x root/root 9405 2022-12-25 18:00 ./usr/share/fasta3/scripts/lav2plt.pl
-rwxr-xr-x root/root 15015 2022-12-25 18:00 ./usr/share/fasta3/scripts/lavplt_ps.pl
-rwxr-xr-x root/root 13106 2022-12-25 18:00 ./usr/share/fasta3/scripts/lavplt_svg.pl
-rwxr-xr-x root/root 1909 2022-12-25 18:00 ./usr/share/fasta3/scripts/links2sql.pl
-rwxr-xr-x root/root 9771 2022-11-14 21:42 ./usr/share/fasta3/scripts/m8CBl_to_plot2.R
-rwxr-xr-x root/root 11092 2022-12-25 18:00 ./usr/share/fasta3/scripts/m8_btop_msa.pl
-rwxr-xr-x root/root 18926 2022-12-25 18:00 ./usr/share/fasta3/scripts/m9B_btop_msa.pl
-rwxr-xr-x root/root 16976 2022-12-25 18:00 ./usr/share/fasta3/scripts/map_exon_coords.py
-rwxr-xr-x root/root 7659 2022-12-25 18:00 ./usr/share/fasta3/scripts/merge_blast_btab.pl
-rwxr-xr-x root/root 9415 2022-12-25 18:00 ./usr/share/fasta3/scripts/merge_fasta_btab.pl
-rwxr-xr-x root/root 19093 2022-11-14 21:42 ./usr/share/fasta3/scripts/plot_domain2t.cgi
-rwxr-xr-x root/root 5286 2022-12-25 18:00 ./usr/share/fasta3/scripts/relabel_domains.py
-rwxr-xr-x root/root 30354 2022-12-25 18:00 ./usr/share/fasta3/scripts/rename_exons.py
-rwxr-xr-x root/root 3042 2022-12-25 18:00 ./usr/share/fasta3/scripts/summ_domain_ident.pl
-rwxr-xr-x root/root 706 2022-12-25 18:00 ./usr/share/fasta3/scripts/test_ann_scripts.sh
-rwxr-xr-x root/root 2978 2022-12-25 18:00 ./usr/share/fasta3/scripts/test_py.sh
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/man/
drwxr-xr-x root/root 0 2022-12-25 18:00 ./usr/share/man/man1/
-rw-r--r-- root/root 7358 2022-12-25 18:00 ./usr/share/man/man1/fasta36.1.gz
-rw-r--r-- root/root 2195 2022-12-25 18:00 ./usr/share/man/man1/fastf3.1.gz
-rw-r--r-- root/root 2119 2022-12-25 18:00 ./usr/share/man/man1/fasts3.1.gz
-rw-r--r-- root/root 523 2022-12-25 18:00 ./usr/share/man/man1/map_db.1.gz
-rw-r--r-- root/root 2146 2022-12-25 18:00 ./usr/share/man/man1/prss3.1.gz
-rw-r--r-- root/root 402 2022-12-25 18:00 ./usr/share/man/man1/ps_lav.1.gz
+------------------------------------------------------------------------------+
| Post Build |
+------------------------------------------------------------------------------+
+------------------------------------------------------------------------------+
| Cleanup |
+------------------------------------------------------------------------------+
Purging /<<BUILDDIR>>
Not cleaning session: cloned chroot in use
+------------------------------------------------------------------------------+
| Summary |
+------------------------------------------------------------------------------+
Build Architecture: armhf
Build-Space: 54676
Build-Time: 2585
Distribution: bookworm-staging
Host Architecture: armhf
Install-Time: 328
Job: fasta3_36.3.8i.14-Nov-2020-1
Machine Architecture: armhf
Package: fasta3
Package-Time: 2971
Source-Version: 36.3.8i.14-Nov-2020-1
Space: 54676
Status: successful
Version: 36.3.8i.14-Nov-2020-1
--------------------------------------------------------------------------------
Finished at 2022-12-28T07:36:24Z
Build needed 00:49:31, 54676k disc space