fasta3 →
36.3.8i.14-Nov-2020-1+b8 →
armhf → 2024-08-25 12:54:02
sbuild (Debian sbuild) 0.85.0 (04 January 2023) on test2023
+==============================================================================+
| fasta3 36.3.8i.14-Nov-2020-1+b8 (armhf) Sun, 25 Aug 2024 12:09:26 +0000 |
+==============================================================================+
Package: fasta3
Version: 36.3.8i.14-Nov-2020-1+b8
Source Version: 36.3.8i.14-Nov-2020-1
Distribution: trixie-staging
Machine Architecture: arm64
Host Architecture: armhf
Build Architecture: armhf
Build Type: any
I: NOTICE: Log filtering will replace 'var/run/schroot/mount/trixie-staging-armhf-sbuild-77f200d9-30c3-4815-9ce4-c32a7813701f' with '<<CHROOT>>'
I: NOTICE: Log filtering will replace 'build/fasta3-lvJF1d/resolver-uG6nqe' with '<<RESOLVERDIR>>'
+------------------------------------------------------------------------------+
| Update chroot |
+------------------------------------------------------------------------------+
Get:1 http://172.17.4.1/private trixie-staging InRelease [11.3 kB]
Get:2 http://172.17.4.1/private trixie-staging/main Sources [14.7 MB]
Get:3 http://172.17.4.1/private trixie-staging/main armhf Packages [15.2 MB]
Fetched 29.9 MB in 5s (5584 kB/s)
Reading package lists...
W: http://172.17.4.1/private/dists/trixie-staging/InRelease: Key is stored in legacy trusted.gpg keyring (/etc/apt/trusted.gpg), see the DEPRECATION section in apt-key(8) for details.
+------------------------------------------------------------------------------+
| Fetch source files |
+------------------------------------------------------------------------------+
Check APT
---------
Checking available source versions...
Download source files with APT
------------------------------
Reading package lists...
NOTICE: 'fasta3' packaging is maintained in the 'Git' version control system at:
https://salsa.debian.org/med-team/fasta3.git
Please use:
git clone https://salsa.debian.org/med-team/fasta3.git
to retrieve the latest (possibly unreleased) updates to the package.
Need to get 1416 kB of source archives.
Get:1 http://172.17.4.1/private trixie-staging/main fasta3 36.3.8i.14-Nov-2020-1 (dsc) [2224 B]
Get:2 http://172.17.4.1/private trixie-staging/main fasta3 36.3.8i.14-Nov-2020-1 (tar) [1403 kB]
Get:3 http://172.17.4.1/private trixie-staging/main fasta3 36.3.8i.14-Nov-2020-1 (diff) [10.8 kB]
Fetched 1416 kB in 0s (5743 kB/s)
Download complete and in download only mode
I: NOTICE: Log filtering will replace 'build/fasta3-lvJF1d/fasta3-36.3.8i.14-Nov-2020' with '<<PKGBUILDDIR>>'
I: NOTICE: Log filtering will replace 'build/fasta3-lvJF1d' with '<<BUILDDIR>>'
+------------------------------------------------------------------------------+
| Install package build dependencies |
+------------------------------------------------------------------------------+
Setup apt archive
-----------------
Merged Build-Depends: debhelper-compat (= 13), libsimde-dev, build-essential, fakeroot
Filtered Build-Depends: debhelper-compat (= 13), libsimde-dev, build-essential, fakeroot
dpkg-deb: building package 'sbuild-build-depends-main-dummy' in '/<<RESOLVERDIR>>/apt_archive/sbuild-build-depends-main-dummy.deb'.
Ign:1 copy:/<<RESOLVERDIR>>/apt_archive ./ InRelease
Get:2 copy:/<<RESOLVERDIR>>/apt_archive ./ Release [609 B]
Ign:3 copy:/<<RESOLVERDIR>>/apt_archive ./ Release.gpg
Get:4 copy:/<<RESOLVERDIR>>/apt_archive ./ Sources [631 B]
Get:5 copy:/<<RESOLVERDIR>>/apt_archive ./ Packages [663 B]
Fetched 1903 B in 0s (0 B/s)
Reading package lists...
Reading package lists...
Install main build dependencies (apt-based resolver)
----------------------------------------------------
Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
ca-certificates cron cron-daemon-common dbus dbus-bin dbus-daemon
dbus-session-bus-common dbus-system-bus-common dmsetup
libalgorithm-diff-perl libalgorithm-merge-perl libapparmor1
libarchive-cpio-perl libcryptsetup12 libdbus-1-3 libdevmapper1.02.1
libexpat1 libfdisk1 libfile-fcntllock-perl libjson-c5 libkmod2 libltdl-dev
libltdl7 libmail-sendmail-perl libsys-hostname-long-perl libsystemd-shared
netbase openssl systemd systemd-dev systemd-timesyncd
Use 'apt autoremove' to remove them.
The following additional packages will be installed:
libsimde-dev
The following NEW packages will be installed:
libsimde-dev sbuild-build-depends-main-dummy
0 upgraded, 2 newly installed, 0 to remove and 67 not upgraded.
Need to get 466 kB of archives.
After this operation, 8551 kB of additional disk space will be used.
Get:1 copy:/<<RESOLVERDIR>>/apt_archive ./ sbuild-build-depends-main-dummy 0.invalid.0 [880 B]
Get:2 http://172.17.4.1/private trixie-staging/main armhf libsimde-dev all 0.8.2-1 [465 kB]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 466 kB in 0s (3654 kB/s)
Selecting previously unselected package libsimde-dev.
(Reading database ... 16263 files and directories currently installed.)
Preparing to unpack .../libsimde-dev_0.8.2-1_all.deb ...
Unpacking libsimde-dev (0.8.2-1) ...
Selecting previously unselected package sbuild-build-depends-main-dummy.
Preparing to unpack .../sbuild-build-depends-main-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-main-dummy (0.invalid.0) ...
Setting up libsimde-dev (0.8.2-1) ...
Setting up sbuild-build-depends-main-dummy (0.invalid.0) ...
+------------------------------------------------------------------------------+
| Check architectures |
+------------------------------------------------------------------------------+
Arch check ok (armhf included in any all)
+------------------------------------------------------------------------------+
| Build environment |
+------------------------------------------------------------------------------+
Kernel: Linux 6.1.47-v8+ #1 SMP PREEMPT Fri Sep 1 07:05:33 BST 2023 arm64 (aarch64)
Toolchain package versions: binutils_2.41-6+rpi1+b1 dpkg-dev_1.22.6+rpi1 g++-12_12.4.0-1+rpi1 g++-13_13.3.0-1+rpi1 gcc-12_12.4.0-1+rpi1 gcc-13_13.3.0-1+rpi1 libc6-dev_2.38-13+rpi1 libstdc++-12-dev_12.4.0-1+rpi1 libstdc++-13-dev_13.3.0-1+rpi1 libstdc++6_14-20240221-2.1+rpi1 linux-libc-dev_6.5.6-1+rpi1+b3
Package versions: adduser_3.137 apt_2.9.6 autoconf_2.71-3 automake_1:1.16.5-1.3 autopoint_0.22.5-1 autotools-dev_20220109.1 base-files_13.3+rpi1 base-passwd_3.6.4 bash_5.2.21-2.1 binutils_2.41-6+rpi1+b1 binutils-arm-linux-gnueabihf_2.41-6+rpi1+b1 binutils-common_2.41-6+rpi1+b1 bsdextrautils_2.40.2-1 bsdutils_1:2.40.2-1 build-essential_12.10 bzip2_1.0.8-5.1 ca-certificates_20240203 coreutils_9.4-3.1 cpp_4:13.2.0-1+rpi1 cpp-12_12.4.0-1+rpi1 cpp-13_13.3.0-1+rpi1 cpp-13-arm-linux-gnueabihf_13.3.0-1+rpi1 cron_3.0pl1-189 cron-daemon-common_3.0pl1-189 dash_0.5.12-9 dbus_1.14.10-4+b1 dbus-bin_1.14.10-4+b1 dbus-daemon_1.14.10-4+b1 dbus-session-bus-common_1.14.10-4 dbus-system-bus-common_1.14.10-4 debconf_1.5.87 debhelper_13.16 debianutils_5.20 dh-autoreconf_20 dh-strip-nondeterminism_1.14.0-1 diffutils_1:3.10-1 dirmngr_2.2.43-7 dmsetup_2:1.02.196-1+b1 dpkg_1.22.6+rpi1 dpkg-dev_1.22.6+rpi1 dwz_0.15-1+b2 e2fsprogs_1.47.1-1 fakeroot_1.33-1 file_1:5.45-3 findutils_4.10.0-2 g++_4:13.2.0-1+rpi1 g++-12_12.4.0-1+rpi1 g++-13_13.3.0-1+rpi1 g++-13-arm-linux-gnueabihf_13.3.0-1+rpi1 gcc_4:13.2.0-1+rpi1 gcc-10-base_10.4.0-7+rpi1 gcc-12_12.4.0-1+rpi1 gcc-12-base_12.4.0-1+rpi1 gcc-13_13.3.0-1+rpi1 gcc-13-arm-linux-gnueabihf_13.3.0-1+rpi1 gcc-13-base_13.3.0-1+rpi1 gcc-14-base_14-20240221-2.1+rpi1 gcc-7-base_7.5.0-6+rpi1+b2 gcc-8-base_8.4.0-7+rpi1 gcc-9-base_9.4.0-2+rpi1+b1 gettext_0.22.5-1 gettext-base_0.22.5-1 gnupg_2.2.43-7 gnupg-l10n_2.2.43-7 gnupg-utils_2.2.43-7 gpg_2.2.43-7 gpg-agent_2.2.43-7 gpg-wks-client_2.2.43-7 gpgconf_2.2.43-7 gpgsm_2.2.43-7 gpgv_2.2.43-7 grep_3.11-4 groff-base_1.23.0-5 gzip_1.12-1.1 hostname_3.23+nmu2 init-system-helpers_1.66 intltool-debian_0.35.0+20060710.6 libacl1_2.3.2-2+rpi1 libalgorithm-diff-perl_1.201-1 libalgorithm-merge-perl_0.08-5 libapparmor1_3.1.7-1 libapt-pkg6.0t64_2.9.6 libarchive-cpio-perl_0.10-3 libarchive-zip-perl_1.68-1 libasan8_14-20240221-2.1+rpi1 libassuan0_2.5.6-1 libatomic1_14-20240221-2.1+rpi1 libattr1_1:2.5.2-1 libaudit-common_1:3.1.2-4 libaudit1_1:3.1.2-4 libbinutils_2.41-6+rpi1+b1 libblkid1_2.40.2-1 libbsd0_0.12.2-1 libbz2-1.0_1.0.8-5.1 libc-bin_2.38-13+rpi1 libc-dev-bin_2.38-13+rpi1 libc6_2.38-13+rpi1 libc6-dev_2.38-13+rpi1 libcap-ng0_0.8.5-1 libcap2_1:2.66-5 libcc1-0_14-20240221-2.1+rpi1 libcom-err2_1.47.1-1 libcrypt-dev_1:4.4.36-4 libcrypt1_1:4.4.36-4 libcryptsetup12_2:2.7.2-2+rpi1 libctf-nobfd0_2.41-6+rpi1+b1 libctf0_2.41-6+rpi1+b1 libdb5.3t64_5.3.28+dfsg2-7 libdbus-1-3_1.14.10-4+b1 libdebconfclient0_0.272 libdebhelper-perl_13.16 libdevmapper1.02.1_2:1.02.196-1+b1 libdpkg-perl_1.22.6+rpi1 libelf1t64_0.191-1+rpi1 libexpat1_2.6.2-1 libext2fs2t64_1.47.1-1 libfakeroot_1.33-1 libfdisk1_2.40.2-1 libffi8_3.4.6-1 libfile-fcntllock-perl_0.22-4+b3 libfile-stripnondeterminism-perl_1.14.0-1 libgcc-12-dev_12.4.0-1+rpi1 libgcc-13-dev_13.3.0-1+rpi1 libgcc-s1_14-20240221-2.1+rpi1 libgcrypt20_1.11.0-2 libgdbm-compat4t64_1.23-6 libgdbm6t64_1.23-6 libgmp10_2:6.3.0+dfsg-2 libgnutls30t64_3.8.6-2 libgomp1_14-20240221-2.1+rpi1 libgpg-error0_1.49-2 libhogweed6t64_3.10-1 libicu72_72.1-5 libidn2-0_2.3.7-2 libisl23_0.26-3 libjansson4_2.14-2 libjson-c5_0.17-1 libk5crypto3_1.21.2-1 libkeyutils1_1.6.3-3 libkmod2_31+20240202-2+rpi1 libkrb5support0_1.21.2-1 libksba8_1.6.7-2 libldap-2.5-0_2.5.18+dfsg-2 libltdl-dev_2.4.7-7+b1 libltdl7_2.4.7-7+b1 liblz4-1_1.9.4-2+rpi1 liblzma5_5.6.2-2 libmagic-mgc_1:5.45-3 libmagic1t64_1:5.45-3 libmail-sendmail-perl_0.80-3 libmd0_1.1.0-2 libmount1_2.40.2-1 libmpc3_1.3.1-1 libmpfr6_4.2.1-1 libncursesw6_6.5-2 libnettle8t64_3.10-1 libnpth0t64_1.6-3.1 libp11-kit0_0.25.5-2 libpam-modules_1.5.3-7 libpam-modules-bin_1.5.3-7 libpam-runtime_1.5.3-7 libpam0g_1.5.3-7 libpcre2-8-0_10.42-4+b1 libperl5.38t64_5.38.2-5 libpipeline1_1.5.7-2 libreadline8t64_8.2-4 libsasl2-2_2.1.28+dfsg1-6 libsasl2-modules-db_2.1.28+dfsg1-6 libseccomp2_2.5.5-1+rpi1+b1 libselinux1_3.5-2+b2 libsemanage-common_3.5-1 libsemanage2_3.5-1+b1 libsepol2_3.5-2+b1 libsframe1_2.41-6+rpi1+b1 libsimde-dev_0.8.2-1 libsmartcols1_2.40.2-1 libsqlite3-0_3.46.0-1 libss2_1.47.1-1 libssl3t64_3.2.2-1 libstdc++-12-dev_12.4.0-1+rpi1 libstdc++-13-dev_13.3.0-1+rpi1 libstdc++6_14-20240221-2.1+rpi1 libsys-hostname-long-perl_1.5-3 libsystemd-shared_255.3-1+rpi1+b1 libsystemd0_255.3-1+rpi1+b1 libtasn1-6_4.19.0-3+b2 libtinfo6_6.5-2 libtirpc-common_1.3.4+ds-1.3 libtool_2.4.7-7 libubsan1_14-20240221-2.1+rpi1 libuchardet0_0.0.8-1 libudev1_255.3-1+rpi1+b1 libunistring5_1.2-1 libuuid1_2.40.2-1 libxml2_2.9.14+dfsg-1.3+b4 libxxhash0_0.8.2-2+b1 libzstd1_1.5.6+dfsg-1 linux-libc-dev_6.5.6-1+rpi1+b3 login_1:4.15.3-2 logsave_1.47.1-1 lsb-base_11.6+rpi1 m4_1.4.19-4 make_4.3-4.1 man-db_2.12.1-2 mawk_1.3.4.20240622-2 mount_2.40.2-1 nano_8.1-1 ncurses-base_6.5-2 ncurses-bin_6.5-2 netbase_6.4 openssl_3.2.2-1 passwd_1:4.15.3-2 patch_2.7.6-7 perl_5.38.2-5 perl-base_5.38.2-5 perl-modules-5.38_5.38.2-5 pinentry-curses_1.2.1-3+b1 po-debconf_1.0.21+nmu1 raspbian-archive-keyring_20120528.2 readline-common_8.2-4 rpcsvc-proto_1.4.3-1 sbuild-build-depends-main-dummy_0.invalid.0 sed_4.9-2 sensible-utils_0.0.24 systemd_255.3-1+rpi1+b1 systemd-dev_255.3-1+rpi1 systemd-timesyncd_255.3-1+rpi1+b1 sysvinit-utils_3.09-2 tar_1.35+dfsg-3 tzdata_2024a-4 usr-is-merged_39 util-linux_2.40.2-1 xz-utils_5.6.2-2 zlib1g_1:1.3.dfsg+really1.3.1-1
+------------------------------------------------------------------------------+
| Build |
+------------------------------------------------------------------------------+
Unpack source
-------------
-----BEGIN PGP SIGNED MESSAGE-----
Hash: SHA256
Format: 3.0 (quilt)
Source: fasta3
Binary: fasta3, fasta3-doc
Architecture: any all
Version: 36.3.8i.14-Nov-2020-1
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Uploaders: Steffen Moeller <moeller@debian.org>
Homepage: https://fasta.bioch.virginia.edu
Standards-Version: 4.6.2
Vcs-Browser: https://salsa.debian.org/med-team/fasta3
Vcs-Git: https://salsa.debian.org/med-team/fasta3.git
Testsuite: autopkgtest
Testsuite-Triggers: libdbd-mysql-perl, libdbi-perl, libjson-perl, libwww-perl, libxml-twig-perl, python3-mysqldb
Build-Depends: debhelper-compat (= 13), libsimde-dev
Package-List:
fasta3 deb science optional arch=any
fasta3-doc deb doc optional arch=all
Checksums-Sha1:
3469c4307c05081a8bccb647e7d1d9dea0aaf92f 1402674 fasta3_36.3.8i.14-Nov-2020.orig.tar.gz
f7ca0324189992dafe292be375194e88b05bf818 10796 fasta3_36.3.8i.14-Nov-2020-1.debian.tar.xz
Checksums-Sha256:
b4b1c3c9be6beebcbaf4215368e159d69255e34c0bdbc84affa10cdb473ce008 1402674 fasta3_36.3.8i.14-Nov-2020.orig.tar.gz
ae0f5b50b1ffecddbf8fc15bc76ad16c9098416a7d6efb98b824b4b26ab210b8 10796 fasta3_36.3.8i.14-Nov-2020-1.debian.tar.xz
Files:
406264dbafe9b5f4426eee5cc3ffcd25 1402674 fasta3_36.3.8i.14-Nov-2020.orig.tar.gz
a04a9c2a9665878d5a9bd88576429db4 10796 fasta3_36.3.8i.14-Nov-2020-1.debian.tar.xz
-----BEGIN PGP SIGNATURE-----
iQJFBAEBCAAvFiEE8fAHMgoDVUHwpmPKV4oElNHGRtEFAmOolZwRHHRpbGxlQGRl
Ymlhbi5vcmcACgkQV4oElNHGRtEVYBAAjHbg9P0Lz4u4x+aPpW4Iw6gelkT8uh7z
G1WbLQLvvce0KB4zvKaJfu3tbyKwL83DruJ9TV2+tqkF4vBii2E0XL7G3+7xE6pV
MIPAnKo0gsNF4ktnBEfkEaYrp/e/ybdxeY0HSnaHC++9dIkNRr9e+HxhQxcGMIPV
/QpKwCI8lqkiwnAhGCxK4rjVW1Bk4hKNcUKRa+j/9/DOMNGHlRQoMlzmwCk5ucp9
AdtA8X7g/hEoAaGXkiBoSbAzT/OYL4RKB31pcOeS6DIeRwOuAwZJpXr/L6ifY0n5
d7iimMMZp+9UQsRhsW8HiNR2ZiBF1+I7Tij4OUe80WRIIGyDIEWhlHuCEHNsAa1I
IZMfMpJFKvtqZNfHUCtybstbIEQau5Hmfa35LdXR8I866xZ3upDl9iRFxi7LHkyK
Wlk2T/gF1ila3Bj+3dJVHnMU6xB3Mb9/Xr7nLyBu/Mq4RSo4d+qCy0uNvuGncxCK
1WbnatLEVlakQgeRuz5BhsHWk3vZ6GAPqAB9EB1v2At/mUuCvEApFnTFP96IBy9r
vsAnXNnKKNxWl1M5L1A+ySEod6AV7+G/jVMgeF1tkzznR/jKERjbFLeCXtEArt8v
MiZMO0hs3MLAyjyzif9y+WJH1CJ4MNkLKNTOd9w/ERmVS4D2UfZNQO3MNRa+BeMN
Ni7qj0r/qKo=
=HNE5
-----END PGP SIGNATURE-----
gpgv: Signature made Sun Dec 25 18:25:32 2022 UTC
gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1
gpgv: issuer "tille@debian.org"
gpgv: Can't check signature: No public key
dpkg-source: warning: cannot verify inline signature for ./fasta3_36.3.8i.14-Nov-2020-1.dsc: no acceptable signature found
dpkg-source: info: extracting fasta3 in /<<PKGBUILDDIR>>
dpkg-source: info: unpacking fasta3_36.3.8i.14-Nov-2020.orig.tar.gz
dpkg-source: info: unpacking fasta3_36.3.8i.14-Nov-2020-1.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying Makefile.patch
dpkg-source: info: applying local_tests
dpkg-source: info: applying adjust-scripts
Check disk space
----------------
Sufficient free space for build
Hack binNMU version
-------------------
Created changelog entry for binNMU version 36.3.8i.14-Nov-2020-1+b8
User Environment
----------------
APT_CONFIG=/var/lib/sbuild/apt.conf
DEB_BUILD_OPTIONS=parallel=4
HOME=/sbuild-nonexistent
LANG=en_GB.UTF-8
LC_ALL=C.UTF-8
LOGNAME=buildd
PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games
SCHROOT_ALIAS_NAME=trixie-staging-armhf-sbuild
SCHROOT_CHROOT_NAME=trixie-staging-armhf-sbuild
SCHROOT_COMMAND=env
SCHROOT_GID=124
SCHROOT_GROUP=buildd
SCHROOT_SESSION_ID=trixie-staging-armhf-sbuild-77f200d9-30c3-4815-9ce4-c32a7813701f
SCHROOT_UID=114
SCHROOT_USER=buildd
SHELL=/bin/sh
USER=buildd
dpkg-buildpackage
-----------------
Command: dpkg-buildpackage --sanitize-env -us -uc -mRaspbian pi5 test autobuilder <root@raspbian.org> -B -rfakeroot
dpkg-buildpackage: info: source package fasta3
dpkg-buildpackage: info: source version 36.3.8i.14-Nov-2020-1+b8
dpkg-buildpackage: info: source distribution trixie-staging
dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
debian/rules clean
dh clean --sourcedirectory src
debian/rules override_dh_auto_clean
make[1]: Entering directory '/<<PKGBUILDDIR>>'
if [ -d src ]; then cd src && /usr/bin/make -f "../make/Makefile.linux64" clean-up; fi
make[2]: Entering directory '/<<PKGBUILDDIR>>/src'
rm -f *.o fasta36 ssearch36 lalign36 fasts36 fastx36 tfastx36 fasty36 tfasty36 tfasts36 fastm36 tfastm36 fastf36 tfastf36 glsearch36 ggsearch36 map_db; rm -rf ../bin/*
make[2]: Leaving directory '/<<PKGBUILDDIR>>/src'
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
dh_autoreconf_clean -O--sourcedirectory=src
dh_clean -O--sourcedirectory=src
debian/rules binary-arch
dh binary-arch --sourcedirectory src
dh_update_autotools_config -a -O--sourcedirectory=src
dh_autoreconf -a -O--sourcedirectory=src
dh_auto_configure -a -O--sourcedirectory=src
debian/rules override_dh_auto_build
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_build --sourcedirectory make --builddirectory src --buildsystem makefile -- -f "../make/Makefile.linux64"
cd src && make -j4 "INSTALL=install --strip-program=true" -f ../make/Makefile.linux64
make[2]: Entering directory '/<<PKGBUILDDIR>>/src'
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -DCOMP_MLIB -c comp_lib9.c -o comp_mthr9.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c work_thr2.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c pthr_subs2.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -DCOMP_MLIB -c compacc2e.c -o compacc2_t.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mshowbest.c -o showbest.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c build_ares.c -o build_ares.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c re_getlib.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -c mshowalign2.c -o mshowalign2_t.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c htime.c
mshowalign2.c: In function ‘showalign’:
mshowalign2.c:617:64: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
mshowalign2.c:617:68: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c apam.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c doinit.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTA initfa.c -o init_fa.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DLOCAL_SCORE -c scaleswn.c -o scale_se.o
scaleswn.c: In function ‘process_hist’:
scaleswn.c:255:55: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
255 | fprintf(stderr," cannot allocate pstat_union: %ld\n",sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| | unsigned int
| long int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c karlin.c
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnfa.c -o drop_nfa.o
dropnfa.c: In function ‘init_work’:
dropnfa.c:306:77: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
306 | fprintf (stderr,"*** ERROR [%s:%d] - cannot allocate diagonal arrays: %lu\n",
| ~~^
| |
| long unsigned int
| %u
cc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -c -o wm_align.o wm_align.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTA -c cal_cons2.c -o calcons_fa.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c nmgetlib.c -o lgetlib.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mmgetaa.c -o lgetaa_m.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c c_dispn.c
nmgetlib.c: In function ‘open_lib’:
nmgetlib.c:414:76: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
414 | fprintf(stderr,"\n*** Warning [%s:%d] - cannot allocate lmf_str (%ld) for %s\n",
| ~~^
| |
| long int
| %d
415 | __FILE__, __LINE__,sizeof(struct lmf_str),lib_p->file_name);
| ~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
nmgetlib.c: In function ‘sel_hacc_libstr_init’:
nmgetlib.c:2025:71: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2025 | fprintf(stderr, "*** Warning [%s:%d] - cannot allocate acc_hash[%ld]\n",__FILE__, __LINE__,hash_max*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
nmgetlib.c:2031:76: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2031 | fprintf(stderr, "*** Warning [%s:%d] - cannot allocate acc_hash_link[%ld]\n",__FILE__, __LINE__,acc_cnt*sizeof(char *));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
nmgetlib.c: In function ‘sel_hacc_gi_init’:
nmgetlib.c:2152:70: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2152 | fprintf(stderr, "*** Warning [%s:%d] - cannot allocate gi_hash[%ld]\n",__FILE__, __LINE__,hash_max*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
nmgetlib.c:2158:75: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2158 | fprintf(stderr, "*** Warning [%s:%d] - cannot allocate gi_hash_link[%ld]\n",__FILE__, __LINE__,acc_cnt*sizeof(char *));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
nmgetlib.c: In function ‘agetlib’:
nmgetlib.c:636:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
636 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:638:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
638 | fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:681:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
681 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:696:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
696 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘aranlib’:
nmgetlib.c:716:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
716 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘qgetlib’:
nmgetlib.c:778:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
778 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:780:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
780 | fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:811:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
811 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘qranlib’:
nmgetlib.c:834:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
834 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘lgetlib’:
nmgetlib.c:887:7: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
887 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:925:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
925 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘lget_ann’:
nmgetlib.c:949:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
949 | fgets(desc,sizeof(desc),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:951:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
951 | fgets(desc,sizeof(desc),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:955:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
955 | fgets(acc,sizeof(acc),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:957:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
957 | fgets(acc,sizeof(acc),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:965:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
965 | fgets(ver,sizeof(ver),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:967:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
967 | fgets(ver,sizeof(ver),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘lranlib’:
nmgetlib.c:1041:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1041 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1048:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1048 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘pgetlib’:
nmgetlib.c:1086:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1086 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); /* get the extra line */
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1108:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1108 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘pranlib’:
nmgetlib.c:1132:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1132 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1135:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1135 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1137:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1137 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1143:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1143 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘egetlib’:
nmgetlib.c:1227:1: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1227 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘eranlib’:
nmgetlib.c:1257:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1257 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1262:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1262 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1265:56: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1265 | while (lm_fd->lline[0]!='D' || lm_fd->lline[1]!='E') fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1272:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1272 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘igetlib’:
nmgetlib.c:1305:19: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1305 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1336:13: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1336 | fgets(lm_fd->lline,MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1340:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1340 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘iranlib’:
nmgetlib.c:1367:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1367 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1378:11: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1378 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1387:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1387 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘vgetlib’:
nmgetlib.c:1425:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1425 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1464:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1464 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1470:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1470 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘vranlib’:
nmgetlib.c:1497:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1497 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1511:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1511 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1528:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1528 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘gcg_getlib’:
nmgetlib.c:1570:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1570 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1573:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1573 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1575:7: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1575 | fgets(&lm_fd->lline[strlen(lm_fd->lline)-MAX_STR/2],MAX_STR/2,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1595:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1595 | fread((char *)seqp,(size_t)r_block,(size_t)1,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1610:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1610 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘gcg_ranlib’:
nmgetlib.c:1634:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1634 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1643:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1643 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1674:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1674 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c ncbl2_mlib.c -o ncbl2_mlib.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c lib_sel.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c url_subs.c
ncbl2_mlib.c: In function ‘ncbl2_getlibn’:
ncbl2_mlib.c:1434:80: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 7 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
1434 | "*** ERROR [%s:%d] - could not read sequence record: %s %lld %ld != %ld: %d\n",
| ~~^
| |
| long int
| %d
1435 | __FILE__,__LINE__,libstr, *libpos,tmp,seqcnt,*seq);
| ~~~
| |
| size_t {aka unsigned int}
ncbl2_mlib.c:1454:84: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
1454 | fprintf(stderr,"*** ERROR [%s:%d] - could not read sequence record: %lld %ld/%ld\n",
| ~~^
| |
| long int
| %d
1455 | __FILE__,__LINE__, *libpos,tmp,seqcnt);
| ~~~
| |
| size_t {aka unsigned int}
ncbl2_mlib.c:1594:72: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
1594 | fprintf(stderr, "*** ERROR [%s:%d] malloc amb table error size %ld\n",
| ~~^
| |
| long int
| %d
1595 | __FILE__, __LINE__, amb_cnt * sizeof(unsigned int));
| ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
ncbl2_mlib.c: In function ‘load_ncbl2’:
ncbl2_mlib.c:810:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
810 | fread(title_str,(size_t)1,(size_t)title_len,ifile);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:820:7: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
820 | fread(pdb_title_str,(size_t)1,(size_t)pdb_title_len,ifile);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:831:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
831 | fread(date_str,(size_t)1,(size_t)date_len,ifile);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘ncbl2_ranlib’:
ncbl2_mlib.c:1720:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1720 | fread(str,(size_t)1,(size_t)(llen),m_fd->hfile);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:1735:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1735 | fread(my_buff,(size_t)1,llen,m_fd->hfile);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_int4_read’:
ncbl2_mlib.c:1841:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1841 | fread((char *)&b[0],(size_t)1,(size_t)4,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_long4_read’:
ncbl2_mlib.c:1856:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1856 | fread((char *)&b[0],(size_t)1,(size_t)4,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_uint4_read’:
ncbl2_mlib.c:1869:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1869 | fread((char *)&b[0],(size_t)1,(size_t)4,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_long8_read’:
ncbl2_mlib.c:1884:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1884 | fread((char *)&b[0],(size_t)1,(size_t)8,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘ncbi_long8_read’:
ncbl2_mlib.c:1904:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1904 | fread((char *)&b[0],(size_t)1,(size_t)8,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_char_read’:
ncbl2_mlib.c:1911:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1911 | fread(val,(size_t)1,(size_t)1,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_fstr_read’:
ncbl2_mlib.c:1916:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
1916 | fread(val,(size_t)slen,(size_t)1,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -c -o mrandom.o mrandom.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DSSEARCH initfa.c -o init_sw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o dropgsw2_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c smith_waterman_sse2.c
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c wm_align.c -o lwm_align.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSSEARCH -c cal_cons2.c -o calcons_sw.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c pssm_asn_subs.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_MLIB -c comp_lib9.c -o comp_mlib9.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_MLIB -c compacc2e.c -o compacc2_s.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DLALIGN -c mshowalign2.c -o lshowalign.o
mshowalign2.c: In function ‘showalign’:
mshowalign2.c:617:64: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
mshowalign2.c:617:68: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DLALIGN initfa.c -o init_lal.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c last_thresh.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o droplal2_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c lsim4.c
lsim4.c: In function ‘ckalloc’:
lsim4.c:994:47: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
994 | fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
| ~~^ ~~~~~~
| | |
| long int size_t {aka unsigned int}
| %d
lsim4.c:994:51: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
994 | fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
| ~~^ ~~~~
| | |
| long int size_t {aka unsigned int}
| %d
lsim4.c:994:55: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
994 | fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
| ~~^ ~~~~~~
| | |
| long int size_t {aka unsigned int}
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -DLCAL_CONS -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c cal_cons2.c -o calcons_la.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS initfa.c -o init_fs.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c scaleswt.c -o scaleswts.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c last_tat.c
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
scaleswt.c: In function ‘process_hist’:
scaleswt.c:184:72: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
184 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate rs_snion: %ld\n",__FILE__, __LINE__, sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
scaleswt.c: In function ‘last_stats’:
scaleswt.c:1230:67: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
1230 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate rs_s: %ld\n",__FILE__, __LINE__,sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS tatstats.c -o tatstats_fs.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTS -c dropfs2.c -o drop_fs2.o
dropfs2.c: In function ‘init_work’:
dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
| ~~^
| |
| long int
| %d
378 | tat_size * sizeof(struct tat_str *));
| ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTS -c cal_consf.c -o calcons_fs.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTX initfa.c -o init_fx.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c faatran.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropfx2.c -o drop_fx.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTX -DTFAST initfa.c -o init_tfx.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST dropfx2.c -o drop_tfx.o
dropfx2.c: In function ‘do_walign’:
dropfx2.c:2660:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2660 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
2661 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
dropfx2.c: In function ‘do_walign’:
dropfx2.c:2660:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2660 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
2661 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTY initfa.c -o init_fy.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropfz3.c -o drop_fz.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTY -DTFAST initfa.c -o init_tfy.o
dropfz3.c: In function ‘init_work’:
dropfz3.c:629:79: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
629 | fprintf (stderr,"*** ERROR [%s:%d] - cannot allocate diagonal arrays: %lu\n",
| ~~^
| |
| long unsigned int
| %u
dropfz3.c: In function ‘do_walign’:
dropfz3.c:2672:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2672 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
2673 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST dropfz3.c -o drop_tfz.o
dropfz3.c: In function ‘init_work’:
dropfz3.c:629:79: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
629 | fprintf (stderr,"*** ERROR [%s:%d] - cannot allocate diagonal arrays: %lu\n",
| ~~^
| |
| long unsigned int
| %u
dropfz3.c: In function ‘do_walign’:
dropfz3.c:2672:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2672 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
2673 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS -DTFAST initfa.c -o init_tfs.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST -DFASTS dropfs2.c -o drop_tfs.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTS -c cal_consf.c -o calcons_tfs.o
dropfs2.c: In function ‘init_work’:
dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
| ~~^
| |
| long int
| %d
378 | tat_size * sizeof(struct tat_str *));
| ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM initfa.c -o init_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM tatstats.c -o tatstats_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM dropfs2.c -o drop_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTM -c cal_consf.c -o calcons_fm.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
dropfs2.c: In function ‘init_work’:
dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
| ~~^
| |
| long int
| %d
378 | tat_size * sizeof(struct tat_str *));
| ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mshowalign2.c -o mshowalign2_s.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM -DTFAST initfa.c -o init_tfm.o
mshowalign2.c: In function ‘showalign’:
mshowalign2.c:617:64: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
mshowalign2.c:617:68: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
617 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
| ~~^
| |
| long unsigned int
| %u
618 | nc,maxc,strlen(seqc0),strlen(seqc1));
| ~~~~~~~~~~~~~
| |
| size_t {aka unsigned int}
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST -DFASTM dropfs2.c -o drop_tfm.o
dropfs2.c: In function ‘init_work’:
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTM -c cal_consf.c -o calcons_tfm.o
dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
| ~~^
| |
| long int
| %d
378 | tat_size * sizeof(struct tat_str *));
| ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF initfa.c -o init_ff.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTF -c scaleswt.c -o scaleswtf.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF tatstats.c -o tatstats_ff.o
scaleswt.c: In function ‘process_hist’:
scaleswt.c:184:72: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
184 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate rs_snion: %ld\n",__FILE__, __LINE__, sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
scaleswt.c: In function ‘last_stats’:
scaleswt.c:1230:67: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
1230 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate rs_s: %ld\n",__FILE__, __LINE__,sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF dropff2.c -o drop_ff2.o
dropff2.c: In function ‘init_work’:
dropff2.c:120:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
120 | fprintf(stderr, "*** ERROR [%s:%d] - cannot calloc f_str [%lu]\n",
| ~~^
| |
| long unsigned int
| %u
121 | __FILE__, __LINE__, sizeof(struct f_struct));
| ~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
dropff2.c: In function ‘do_walign’:
dropff2.c:1176:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
1176 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
1177 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTF -c cal_consf.c -o calcons_ff.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF -DTFAST initfa.c -o init_tf.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF -DTFAST dropff2.c -o drop_tff.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTF -c cal_consf.c -o calcons_tff.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -DNORMAL_DIST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c scaleswn.c -o scale_sn.o
initfa.c: In function ‘alloc_pam2p’:
dropff2.c: In function ‘init_work’:
dropff2.c:120:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
120 | fprintf(stderr, "*** ERROR [%s:%d] - cannot calloc f_str [%lu]\n",
| ~~^
| |
| long unsigned int
| %u
121 | __FILE__, __LINE__, sizeof(struct f_struct));
| ~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
dropff2.c: In function ‘do_walign’:
dropff2.c:1176:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
1176 | fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
| ~~^
| |
| long unsigned int
| %u
1177 | __FILE__, __LINE__, sizeof(struct a_res_str));
| ~~~~~~~~~~~~~~~~~~~~~~~~
| |
| unsigned int
scaleswn.c: In function ‘process_hist’:
scaleswn.c:255:55: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
255 | fprintf(stderr," cannot allocate pstat_union: %ld\n",sizeof(struct pstat_str));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~
| | |
| | unsigned int
| long int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DGLSEARCH initfa.c -o init_lnw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -DSW_SSE2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnnw2.c -o droplnw_sse.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c glocal_sse2.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DGGSEARCH -c wm_align.c -o gwm_align.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DGGSEARCH initfa.c -o init_gnw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -DGLOBAL_GLOBAL -DSW_SSE2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnnw2.c -o dropgnw_sse.o
initfa.c: In function ‘alloc_pam2p’:
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c global_sse2.c
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
2001 | "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
| ~~^ ~~~~~~~~~~~~~~~~~~~~~~~
| | |
| long int unsigned int
| %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -o ../bin/map_db map_db.c
map_db.c: In function ‘main’:
map_db.c:149:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
149 | fgets(lname,sizeof(lname),stdin);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
map_db.c: In function ‘gbf_get_ent’:
map_db.c:512:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
512 | fgets(lline,MAXLINE,libf);
| ^~~~~~~~~~~~~~~~~~~~~~~~~
map_db.c: In function ‘src_int4_read’:
map_db.c:524:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
524 | fread((char *)&b[0],(size_t)1,(size_t)4,fd);
| ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -o ../bin/fasta36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fa.o drop_nfa.o wm_align.o calcons_fa.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread
cc -o ../bin/ssearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_sw_sse.o dropgsw2_sse.o smith_waterman_sse2.o lwm_align.o calcons_sw.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread
cc -o ../bin/lalign36 comp_mlib9.o compacc2_s.o showbest.o build_ares.o re_getlib.o lshowalign.o htime.o apam.o doinit.o init_lal.o droplal2_sse.o smith_waterman_sse2.o lsim4.o calcons_la.o scale_se.o karlin.o last_thresh.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc -o ../bin/fasts36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fs.o drop_fs2.o calcons_fs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
initfa.c: In function ‘get_lambda.constprop’:
initfa.c:2225:54: warning: argument 1 value ‘3294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2225 | if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
initfa.c: In function ‘get_lambda.constprop’:
initfa.c:2225:54: warning: argument 1 value ‘3294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2225 | if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
cc -o ../bin/fastx36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fx.o drop_fx.o faatran.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc -o ../bin/tfastx36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfx.o drop_tfx.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc -o ../bin/fasty36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fy.o drop_fz.o faatran.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc -o ../bin/tfasty36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfy.o drop_tfz.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
cc -o ../bin/tfasts36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfs.o drop_tfs.o calcons_tfs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc -o ../bin/fastm36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fm.o drop_fm.o calcons_fm.o scaleswts.o last_tat.o tatstats_fm.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc -o ../bin/tfastm36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_s.o htime.o apam.o doinit.o init_tfm.o drop_tfm.o calcons_tfm.o scaleswts.o tatstats_fm.o last_tat.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowalign2.c:85:1: warning: type of ‘buf_align_seq’ does not match original declaration [-Wlto-type-mismatch]
85 | buf_align_seq(unsigned char **aa0, int n0,
| ^
compacc2e.c:3597:1: note: type mismatch in parameter 8
3597 | buf_align_seq(unsigned char **aa0, int n0,
| ^
compacc2e.c:3597:1: note: ‘buf_align_seq’ was previously declared here
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc -o ../bin/fastf36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_ff.o drop_ff2.o calcons_ff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
cc -o ../bin/tfastf36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tf.o drop_tff.o calcons_tff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
236 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: type mismatch in parameter 7
164 | process_hist(struct stat_str *sptr, int nstats,
| ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc -o ../bin/glsearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_lnw_sse.o droplnw_sse.o glocal_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc -o ../bin/ggsearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_gnw_sse.o dropgnw_sse.o global_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
959 | re_openlib(struct lmf_str *, int outtty);
| ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
514 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
| ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
| ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
| ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
initfa.c:2036:1: note: type mismatch in parameter 6
2036 | last_calc(
| ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
| ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
| ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
| ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
initfa.c: In function ‘get_lambda.constprop’:
initfa.c:2225:54: warning: argument 1 value ‘3294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2225 | if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
initfa.c: In function ‘get_lambda.constprop’:
initfa.c:2225:54: warning: argument 1 value ‘3294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2225 | if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
2124 | if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
| ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
675 | extern void *calloc (size_t __nmemb, size_t __size)
| ^
make[2]: Leaving directory '/<<PKGBUILDDIR>>/src'
# convoluted, but necessary to allow cross builds
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_auto_test
make[1]: Entering directory '/<<PKGBUILDDIR>>'
cd test ; ./test2G.sh && ./test.sh && ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg
STARTING FASTA36 Sun Aug 25 12:11:05 UTC 2024 on test2023
Linux test2023 6.1.47-v8+ #1 SMP PREEMPT Fri Sep 1 07:05:33 BST 2023 aarch64 GNU/Linux
starting prss36(ssearch/fastx) Sun Aug 25 12:11:05 UTC 2024
done
starting lalign36 Sun Aug 25 12:11:05 UTC 2024
FINISHED Sun Aug 25 12:12:59 UTC 2024
STARTING FASTA36 Sun Aug 25 12:12:59 UTC 2024 on test2023
Linux test2023 6.1.47-v8+ #1 SMP PREEMPT Fri Sep 1 07:05:33 BST 2023 aarch64 GNU/Linux
starting prss36(ssearch/fastx) Sun Aug 25 12:12:59 UTC 2024
done
starting lalign36 Sun Aug 25 12:13:00 UTC 2024
FINISHED Sun Aug 25 12:14:55 UTC 2024
# ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg
FASTA searches a protein or DNA sequence data bank
version 36.3.8i Nov, 2022
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: ../seq/mgstm1.aa
1>>>sp|P10649|GSTM1_MOUSE Glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; Glutathione S-transferase GT8.7; pmGT10 - 218 aa
Library: ../seq/prot_test.lseg
2267 residues in 12 sequences
Statistics: (shuffled [479]) MLE statistics: Lambda= 0.1648; K=0.00473
statistics sampled from 4 (4) to 479 sequences
Algorithm: FASTA (3.8 Nov 2011) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.667), E-opt: 0.2 (0.333), width: 16
Scan time: 0.000
The best scores are: opt bits E(12)
sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu ( 218) 1242 305.1 8.3e-87
sp|P00502|GSTA1_RAT Glutathione S-transferase alph ( 222) 237 66.1 7.2e-15
sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Ho ( 142) 51 21.9 0.095
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinas ( 351) 43 20.0 0.85
sp|P14960|RBS_GUITH Ribulose bisphosphate carboxyl ( 139) 36 18.3 1.1
sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG ( 108) 31 17.1 1.8
sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodyte ( 105) 30 16.9 2
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle ( 160) 30 16.9 3
sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A ( 567) 37 18.6 3.3
sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A ( 95) 26 16.0 3.3
sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococc ( 54) 22 15.0 3.6
sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Ho ( 106) 23 15.2 5.4
>>sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 O (218 aa)
initn: 1242 init1: 1242 opt: 1242 Z-score: 1610.3 bits: 305.1 E(12): 8.3e-87
Smith-Waterman score: 1242; 78.0% identity (95.4% similar) in 218 aa overlap (1-218:1-218)
10 20 30 40 50 60
sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL
::::::::..:::.: ::.:::::::::.::.::::::::.:::::::::::::::::::
sp|P09 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
10 20 30 40 50 60
70 80 90 100 110 120
sp|P10 PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF
::::::.:::::::::: :.::::.: ::::::.::.::.:::.::..::: :.::::.:
sp|P09 PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
70 80 90 100 110 120
130 140 150 160 170 180
sp|P10 EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN
:: ::..:. .:::.:::::::::::::::.:.:.::::.::.:: .:.:::::::::::
sp|P09 EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
130 140 150 160 170 180
190 200 210
sp|P10 LRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
:.::..:::::.::::::::::.. :.::::: :.::
sp|P09 LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
190 200 210
>>sp|P00502|GSTA1_RAT Glutathione S-transferase alpha-1 (222 aa)
initn: 204 init1: 73 opt: 237 Z-score: 318.8 bits: 66.1 E(12): 7.2e-15
Smith-Waterman score: 237; 27.4% identity (57.0% similar) in 223 aa overlap (4-218:6-218)
10 20 30 40 50
sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKL--GLD
.: :.:.:: . :: :: . .::: : .: ::.: .:
sp|P00 MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEK---------FIQSPEDLEKLKKDGNLM
10 20 30 40 50
60 70 80 90 100 110
sp|P10 FPNLPYL-IDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMD-TRMQLIML
: ..:.. ::: :..:. ::: :.: :. : :. .:: :. . ..: :.: . ..
sp|P00 FDQVPMVEIDG-MKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLV
60 70 80 90 100 110
120 130 140 150 160 170
sp|P10 CYNPDFEKQKPEFLK--TIPEKMKLYSEFLGK--RPWFAGDKVTYVDFLAYDILDQYRMF
:: .. : . : : . . . . : . . ...:...: ::. ..: . :
sp|P00 ICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEF
120 130 140 150 160 170
180 190 200 210
sp|P10 EPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
. . : .:: :. : .:. .: ... ... . :. .:. . . :
sp|P00 DASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
180 190 200 210 220
>>sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo s (142 aa)
initn: 40 init1: 40 opt: 51 Z-score: 83.2 bits: 21.9 E(12): 0.095
Smith-Waterman score: 51; 25.6% identity (69.2% similar) in 39 aa overlap (177-214:36-73)
150 160 170 180 190 200
sp|P10 WFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS-SRYIA
.::. . .. .:. :.. :: .:. .. .:
sp|P69 ADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFD-LSHGSAQVKGHGKKVA
10 20 30 40 50 60
210
sp|P10 TPIFSKMAHWSNK
. . .::
sp|P69 DALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHA
70 80 90 100 110 120
>>sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase ca (351 aa)
initn: 43 init1: 43 opt: 43 Z-score: 65.9 bits: 20.0 E(12): 0.85
Smith-Waterman score: 54; 23.6% identity (47.2% similar) in 72 aa overlap (137-206:229-300)
110 120 130 140 150 160
sp|P10 TRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQ
.: : :.:: . . . .. .
sp|P00 LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRF
200 210 220 230 240 250
170 180 190 200 210
sp|P10 YRMFEPKCLDAFPNLR--DFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
: : . :: :. :: .::. .:. ...::
sp|P00 PSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPK
260 270 280 290 300 310
sp|P00 FKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
320 330 340 350
>>sp|P14960|RBS_GUITH Ribulose bisphosphate carboxylase (139 aa)
initn: 56 init1: 36 opt: 36 Z-score: 64.1 bits: 18.3 E(12): 1.1
Smith-Waterman score: 36; 57.1% identity (85.7% similar) in 7 aa overlap (7-13:47-53)
10 20 30
sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMG
::.. ::
sp|P14 EQIVKQIQYAISKNWALNVEWTDDPHPRNAYWDLWGLPLFGIKDPAAVMFEINACRKAKP
20 30 40 50 60 70
40 50 60 70 80 90
sp|P10 DAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIR
sp|P14 ACYVKVNAFDNSRGVESCCLSFIVQRPTSNEPGFQLIRSEVDSRNIRYTIQSYASTRPEG
80 90 100 110 120 130
>>sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS= (108 aa)
initn: 31 init1: 31 opt: 31 Z-score: 59.7 bits: 17.1 E(12): 1.8
Smith-Waterman score: 33; 36.0% identity (54.0% similar) in 50 aa overlap (150-190:16-64)
120 130 140 150 160 170
sp|P10 FEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDI---LDQYRMFE---PK
::.:: . . :: :. :.. ::
sp|P01 DIQMTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPK
10 20 30 40
180 190 200 210
sp|P10 CL--DAFPNLRDFL-ARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
: :: ::. . .:: :
sp|P01 ILIYDA-SNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKL
50 60 70 80 90 100
>>sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodytes GN (105 aa)
initn: 30 init1: 30 opt: 30 Z-score: 58.6 bits: 16.9 E(12): 2
Smith-Waterman score: 36; 26.5% identity (54.4% similar) in 68 aa overlap (129-193:28-88)
100 110 120 130 140 150
sp|P10 IVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWF---AGDKVTY
:: :. :... :. : . :..:
sp|P99 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKG
10 20 30 40 50
160 170 180 190 200 210
sp|P10 VDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHW
. . . : : .: . .:: .:. . . : :.::
sp|P99 I-IWGEDTLMEY-LENPK--KYIPGTKMI---FVGIKKKEERADLIAYLKKATNE
60 70 80 90 100
sp|P10 SNK
>>sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=H (160 aa)
initn: 30 init1: 30 opt: 30 Z-score: 55.3 bits: 16.9 E(12): 3
Smith-Waterman score: 41; 25.9% identity (63.0% similar) in 54 aa overlap (44-92:13-62)
20 30 40 50 60 70
sp|P10 THPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--
:. . .:: ..:. . ::. :.
sp|P02 MTDQQAEARSYLSEEMIAEFKAAFDM----FDADGGGDISVK
10 20 30
80 90 100 110 120
sp|P10 QSNAILRYLAR---KHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFL
. ....:.:.. :..::. ::
sp|P02 ELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAE
40 50 60 70 80 90
>>sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A viru (567 aa)
initn: 37 init1: 37 opt: 37 Z-score: 54.4 bits: 18.6 E(12): 3.3
Smith-Waterman score: 50; 28.2% identity (64.1% similar) in 39 aa overlap (74-111:399-437)
50 60 70 80 90 100
sp|P10 SQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARK-HHLDGETEEERIRADIVEN
: ... .: :... : : . : . .:.
sp|P03 GFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEK
370 380 390 400 410 420
110 120 130 140 150 160
sp|P10 QVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYD
: ::...:
sp|P03 YVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYH
430 440 450 460 470 480
>>sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A31 O (95 aa)
initn: 26 init1: 26 opt: 26 Z-score: 54.2 bits: 16.0 E(12): 3.3
Smith-Waterman score: 30; 54.5% identity (63.6% similar) in 11 aa overlap (115-125:86-94)
90 100 110 120 130 140
sp|P10 HLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGK
: :: ::.:
sp|P60 SRGKVVELGCAATCPSKKPYEEVTCCSTDKC-NPH-PKQRPG
60 70 80 90
150 160 170 180 190 200
sp|P10 RPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYI
>>sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococcus a (54 aa)
initn: 22 init1: 22 opt: 22 Z-score: 53.5 bits: 15.0 E(12): 3.6
Smith-Waterman score: 25; 50.0% identity (100.0% similar) in 4 aa overlap (171-174:15-18)
150 160 170 180 190 200
sp|P10 FLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS
.:.:
sp|P00 AYVINDSCIACGACKPECPVNIQQGSIYAIDADSCIDCGSCASV
10 20 30 40
210
sp|P10 SRYIATPIFSKMAHWSNK
sp|P00 CPVGAPNPED
50
>>sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Homo s (106 aa)
initn: 23 init1: 23 opt: 23 Z-score: 49.5 bits: 15.2 E(12): 5.4
Smith-Waterman score: 35; 18.3% identity (53.5% similar) in 71 aa overlap (58-124:12-82)
30 40 50 60 70 80
sp|P10 YDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--QSNAILRYLARKHH
:. : .:. ... .: : . .
sp|P01 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK
10 20 30 40
90 100 110 120 130 140
sp|P10 LDGETEEERIRADIVENQVMDTRMQL--IMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLG
.:. . . ...:.. :. ..: . . :.::.:
sp|P01 VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
50 60 70 80 90 100
150 160 170 180 190 200
sp|P10 KRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRY
sp|P01 NRGEC
218 residues in 1 query sequences
2267 residues in 12 library sequences
Tcomplib [36.3.8i Nov, 2022] (4 proc in memory [0G])
start: Sun Aug 25 12:14:55 2024 done: Sun Aug 25 12:14:55 2024
Total Scan time: 0.000 Total Display time: 0.000
Function used was FASTA [36.3.8i Nov, 2022]
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
create-stamp debian/debhelper-build-stamp
dh_testroot -a -O--sourcedirectory=src
dh_prep -a -O--sourcedirectory=src
dh_auto_install -a -O--sourcedirectory=src
dh_install -a -O--sourcedirectory=src
dh_installdocs -a -O--sourcedirectory=src
dh_installchangelogs -a -O--sourcedirectory=src
dh_installexamples -a -O--sourcedirectory=src
dh_installman -a -O--sourcedirectory=src
dh_installsystemduser -a -O--sourcedirectory=src
dh_perl -a -O--sourcedirectory=src
dh_link -a -O--sourcedirectory=src
dh_strip_nondeterminism -a -O--sourcedirectory=src
debian/rules override_dh_compress
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_compress --exclude=.pdf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
dh_fixperms -a -O--sourcedirectory=src
dh_missing -a -O--sourcedirectory=src
dh_dwz -a -O--sourcedirectory=src
dh_strip -a -O--sourcedirectory=src
dh_makeshlibs -a -O--sourcedirectory=src
dh_shlibdeps -a -O--sourcedirectory=src
dpkg-shlibdeps: warning: diversions involved - output may be incorrect
diversion by libc6 from: /lib/ld-linux-armhf.so.3
dpkg-shlibdeps: warning: diversions involved - output may be incorrect
diversion by libc6 to: /lib/ld-linux-armhf.so.3.usr-is-merged
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/fasta3/usr/bin/ggsearch36 debian/fasta3/usr/bin/tfastm36 debian/fasta3/usr/bin/lalign36 debian/fasta3/usr/bin/fasts36 debian/fasta3/usr/bin/fastx36 debian/fasta3/usr/bin/fasta36 debian/fasta3/usr/bin/glsearch36 debian/fasta3/usr/bin/tfasts36 debian/fasta3/usr/bin/fastf36 debian/fasta3/usr/bin/map_db debian/fasta3/usr/bin/fastm36 debian/fasta3/usr/bin/tfasty36 debian/fasta3/usr/bin/ssearch36 debian/fasta3/usr/bin/tfastf36 debian/fasta3/usr/bin/tfastx36 debian/fasta3/usr/bin/fasty36 were not linked against ld-linux-armhf.so.3 (they use none of the library's symbols)
dh_installdeb -a -O--sourcedirectory=src
dh_gencontrol -a -O--sourcedirectory=src
dh_md5sums -a -O--sourcedirectory=src
dh_builddeb -a -O--sourcedirectory=src
dpkg-deb: building package 'fasta3-dbgsym' in '../fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b8_armhf.deb'.
dpkg-deb: building package 'fasta3' in '../fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.deb'.
dpkg-genbuildinfo --build=any -O../fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.buildinfo
dpkg-genchanges --build=any -mRaspbian pi5 test autobuilder <root@raspbian.org> -O../fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.changes
dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included)
dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
--------------------------------------------------------------------------------
Build finished at 2024-08-25T12:15:05Z
Finished
--------
I: Built successfully
+------------------------------------------------------------------------------+
| Changes |
+------------------------------------------------------------------------------+
fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.changes:
----------------------------------------------
Format: 1.8
Date: Sun, 25 Aug 2024 12:09:40 +0000
Source: fasta3 (36.3.8i.14-Nov-2020-1)
Binary: fasta3 fasta3-dbgsym
Binary-Only: yes
Architecture: armhf
Version: 36.3.8i.14-Nov-2020-1+b8
Distribution: trixie-staging
Urgency: low
Maintainer: Raspbian pi5 test autobuilder <root@raspbian.org>
Changed-By: Raspbian pi5 test autobuilder <root@raspbian.org>
Description:
fasta3 - tools for searching collections of biological sequences
Changes:
fasta3 (36.3.8i.14-Nov-2020-1+b8) trixie-staging; urgency=low, binary-only=yes
.
* Binary-only non-maintainer upload for armhf; no source changes.
* rebuild due to debcheck failure
Checksums-Sha1:
3c67c7102a5f6d432283c28fdb3060b0ec45d178 5410056 fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b8_armhf.deb
8113fce30e507a4c2585c99f4e710d12ffc52f32 5465 fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.buildinfo
7da5c5008ab02f526fdc90cdc9a47945a0a56d46 761712 fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.deb
Checksums-Sha256:
56dfbb9384889125eb87a104a339d9d9a6252b6e2675c4493bd4711055cb7077 5410056 fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b8_armhf.deb
1e61fd6199bfe03e1156d3a6738f130cb693be3b1953da734ae8f3596cd4d703 5465 fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.buildinfo
031d65e82f57d67733ca455de04aca3c4ba605addf3338b4ea9f50cfd73a136b 761712 fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.deb
Files:
2b491ed16a89c214a503917cf7ab9f0a 5410056 debug optional fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b8_armhf.deb
51160787a3fbab58d5af0a2b9eeced9f 5465 science optional fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.buildinfo
ab1b075ce1f1d1e94235f35e850bb132 761712 science optional fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.deb
+------------------------------------------------------------------------------+
| Buildinfo |
+------------------------------------------------------------------------------+
Format: 1.0
Source: fasta3 (36.3.8i.14-Nov-2020-1)
Binary: fasta3 fasta3-dbgsym
Architecture: armhf
Version: 36.3.8i.14-Nov-2020-1+b8
Binary-Only-Changes:
fasta3 (36.3.8i.14-Nov-2020-1+b8) trixie-staging; urgency=low, binary-only=yes
.
* Binary-only non-maintainer upload for armhf; no source changes.
* rebuild due to debcheck failure
.
-- Raspbian pi5 test autobuilder <root@raspbian.org> Sun, 25 Aug 2024 12:09:40 +0000
Checksums-Md5:
2b491ed16a89c214a503917cf7ab9f0a 5410056 fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b8_armhf.deb
ab1b075ce1f1d1e94235f35e850bb132 761712 fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.deb
Checksums-Sha1:
3c67c7102a5f6d432283c28fdb3060b0ec45d178 5410056 fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b8_armhf.deb
7da5c5008ab02f526fdc90cdc9a47945a0a56d46 761712 fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.deb
Checksums-Sha256:
56dfbb9384889125eb87a104a339d9d9a6252b6e2675c4493bd4711055cb7077 5410056 fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b8_armhf.deb
031d65e82f57d67733ca455de04aca3c4ba605addf3338b4ea9f50cfd73a136b 761712 fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.deb
Build-Origin: Raspbian
Build-Architecture: armhf
Build-Date: Sun, 25 Aug 2024 12:15:05 +0000
Build-Path: /<<PKGBUILDDIR>>
Build-Tainted-By:
merged-usr-via-aliased-dirs
Installed-Build-Depends:
autoconf (= 2.71-3),
automake (= 1:1.16.5-1.3),
autopoint (= 0.22.5-1),
autotools-dev (= 20220109.1),
base-files (= 13.3+rpi1),
base-passwd (= 3.6.4),
bash (= 5.2.21-2.1),
binutils (= 2.41-6+rpi1+b1),
binutils-arm-linux-gnueabihf (= 2.41-6+rpi1+b1),
binutils-common (= 2.41-6+rpi1+b1),
bsdextrautils (= 2.40.2-1),
bsdutils (= 1:2.40.2-1),
build-essential (= 12.10),
bzip2 (= 1.0.8-5.1),
coreutils (= 9.4-3.1),
cpp (= 4:13.2.0-1+rpi1),
cpp-12 (= 12.4.0-1+rpi1),
cpp-13 (= 13.3.0-1+rpi1),
cpp-13-arm-linux-gnueabihf (= 13.3.0-1+rpi1),
dash (= 0.5.12-9),
debconf (= 1.5.87),
debhelper (= 13.16),
debianutils (= 5.20),
dh-autoreconf (= 20),
dh-strip-nondeterminism (= 1.14.0-1),
diffutils (= 1:3.10-1),
dpkg (= 1.22.6+rpi1),
dpkg-dev (= 1.22.6+rpi1),
dwz (= 0.15-1+b2),
file (= 1:5.45-3),
findutils (= 4.10.0-2),
g++ (= 4:13.2.0-1+rpi1),
g++-13 (= 13.3.0-1+rpi1),
g++-13-arm-linux-gnueabihf (= 13.3.0-1+rpi1),
gcc (= 4:13.2.0-1+rpi1),
gcc-12 (= 12.4.0-1+rpi1),
gcc-12-base (= 12.4.0-1+rpi1),
gcc-13 (= 13.3.0-1+rpi1),
gcc-13-arm-linux-gnueabihf (= 13.3.0-1+rpi1),
gcc-13-base (= 13.3.0-1+rpi1),
gcc-14-base (= 14-20240221-2.1+rpi1),
gettext (= 0.22.5-1),
gettext-base (= 0.22.5-1),
grep (= 3.11-4),
groff-base (= 1.23.0-5),
gzip (= 1.12-1.1),
hostname (= 3.23+nmu2),
init-system-helpers (= 1.66),
intltool-debian (= 0.35.0+20060710.6),
libacl1 (= 2.3.2-2+rpi1),
libarchive-zip-perl (= 1.68-1),
libasan8 (= 14-20240221-2.1+rpi1),
libatomic1 (= 14-20240221-2.1+rpi1),
libattr1 (= 1:2.5.2-1),
libaudit-common (= 1:3.1.2-4),
libaudit1 (= 1:3.1.2-4),
libbinutils (= 2.41-6+rpi1+b1),
libblkid1 (= 2.40.2-1),
libbz2-1.0 (= 1.0.8-5.1),
libc-bin (= 2.38-13+rpi1),
libc-dev-bin (= 2.38-13+rpi1),
libc6 (= 2.38-13+rpi1),
libc6-dev (= 2.38-13+rpi1),
libcap-ng0 (= 0.8.5-1),
libcap2 (= 1:2.66-5),
libcc1-0 (= 14-20240221-2.1+rpi1),
libcrypt-dev (= 1:4.4.36-4),
libcrypt1 (= 1:4.4.36-4),
libctf-nobfd0 (= 2.41-6+rpi1+b1),
libctf0 (= 2.41-6+rpi1+b1),
libdb5.3t64 (= 5.3.28+dfsg2-7),
libdebconfclient0 (= 0.272),
libdebhelper-perl (= 13.16),
libdpkg-perl (= 1.22.6+rpi1),
libelf1t64 (= 0.191-1+rpi1),
libfile-stripnondeterminism-perl (= 1.14.0-1),
libgcc-12-dev (= 12.4.0-1+rpi1),
libgcc-13-dev (= 13.3.0-1+rpi1),
libgcc-s1 (= 14-20240221-2.1+rpi1),
libgcrypt20 (= 1.11.0-2),
libgdbm-compat4t64 (= 1.23-6),
libgdbm6t64 (= 1.23-6),
libgmp10 (= 2:6.3.0+dfsg-2),
libgomp1 (= 14-20240221-2.1+rpi1),
libgpg-error0 (= 1.49-2),
libicu72 (= 72.1-5),
libisl23 (= 0.26-3),
libjansson4 (= 2.14-2),
liblz4-1 (= 1.9.4-2+rpi1),
liblzma5 (= 5.6.2-2),
libmagic-mgc (= 1:5.45-3),
libmagic1t64 (= 1:5.45-3),
libmd0 (= 1.1.0-2),
libmount1 (= 2.40.2-1),
libmpc3 (= 1.3.1-1),
libmpfr6 (= 4.2.1-1),
libpam-modules (= 1.5.3-7),
libpam-modules-bin (= 1.5.3-7),
libpam-runtime (= 1.5.3-7),
libpam0g (= 1.5.3-7),
libpcre2-8-0 (= 10.42-4+b1),
libperl5.38t64 (= 5.38.2-5),
libpipeline1 (= 1.5.7-2),
libseccomp2 (= 2.5.5-1+rpi1+b1),
libselinux1 (= 3.5-2+b2),
libsframe1 (= 2.41-6+rpi1+b1),
libsimde-dev (= 0.8.2-1),
libsmartcols1 (= 2.40.2-1),
libssl3t64 (= 3.2.2-1),
libstdc++-13-dev (= 13.3.0-1+rpi1),
libstdc++6 (= 14-20240221-2.1+rpi1),
libsystemd0 (= 255.3-1+rpi1+b1),
libtinfo6 (= 6.5-2),
libtool (= 2.4.7-7),
libubsan1 (= 14-20240221-2.1+rpi1),
libuchardet0 (= 0.0.8-1),
libudev1 (= 255.3-1+rpi1+b1),
libunistring5 (= 1.2-1),
libuuid1 (= 2.40.2-1),
libxml2 (= 2.9.14+dfsg-1.3+b4),
libzstd1 (= 1.5.6+dfsg-1),
linux-libc-dev (= 6.5.6-1+rpi1+b3),
m4 (= 1.4.19-4),
make (= 4.3-4.1),
man-db (= 2.12.1-2),
mawk (= 1.3.4.20240622-2),
ncurses-base (= 6.5-2),
ncurses-bin (= 6.5-2),
patch (= 2.7.6-7),
perl (= 5.38.2-5),
perl-base (= 5.38.2-5),
perl-modules-5.38 (= 5.38.2-5),
po-debconf (= 1.0.21+nmu1),
rpcsvc-proto (= 1.4.3-1),
sed (= 4.9-2),
sensible-utils (= 0.0.24),
sysvinit-utils (= 3.09-2),
tar (= 1.35+dfsg-3),
usr-is-merged (= 39),
util-linux (= 2.40.2-1),
xz-utils (= 5.6.2-2),
zlib1g (= 1:1.3.dfsg+really1.3.1-1)
Environment:
DEB_BUILD_OPTIONS="parallel=4"
LANG="en_GB.UTF-8"
LC_ALL="C.UTF-8"
LC_COLLATE="C.UTF-8"
SOURCE_DATE_EPOCH="1724587780"
+------------------------------------------------------------------------------+
| Package contents |
+------------------------------------------------------------------------------+
fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b8_armhf.deb
------------------------------------------------
new Debian package, version 2.0.
size 5410056 bytes: control archive=1344 bytes.
1040 bytes, 12 lines control
1782 bytes, 17 lines md5sums
Package: fasta3-dbgsym
Source: fasta3 (36.3.8i.14-Nov-2020-1)
Version: 36.3.8i.14-Nov-2020-1+b8
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 5943
Depends: fasta3 (= 36.3.8i.14-Nov-2020-1+b8)
Section: debug
Priority: optional
Description: debug symbols for fasta3
Build-Ids: 0cb4d4ba2fdb035745701a4ee2a98dd3d7d09f87 1daeb8ad0e35a3f758cc47f8c34a38dab1e9b392 26c6d1d8d93ccd9ea4575544e321c392473ce2d9 2e4bc98bde2f0241c530f6287b95cb21eb070ace 3409046ac3b84849f30b1fe2f2a382c278d97b3e 44f87cfcf2a934d6a85202f1e75bfb94932cc392 4507ae65291da00abd17d7172776b4ebaaf13070 7aaa17bd1507e32fff7d35b422d848cb3aafb1d5 7e4de25570bf33153d9bae8548158afc3cdee347 7e7ead858f5c88cf7bede638e54644c82d67eb2a b3162c8298ecd8edbf2a73cab62af11e2d4ede03 b9769d0d68b763a3c155ba98f49104eb398f9f99 cd4153f758e96461b498e22290476c689b6dce65 e8c97b3d9c17a48d0b4302ab6fe62e9d931b69a7 f41a2db3725456e33c94c882e17e9301c0deaa85 fed7deb75d93daed62d9567e39dfede6b7811b29
drwxr-xr-x root/root 0 2024-08-25 12:09 ./
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/0c/
-rw-r--r-- root/root 405652 2024-08-25 12:09 ./usr/lib/debug/.build-id/0c/b4d4ba2fdb035745701a4ee2a98dd3d7d09f87.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/1d/
-rw-r--r-- root/root 354504 2024-08-25 12:09 ./usr/lib/debug/.build-id/1d/aeb8ad0e35a3f758cc47f8c34a38dab1e9b392.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/26/
-rw-r--r-- root/root 452336 2024-08-25 12:09 ./usr/lib/debug/.build-id/26/c6d1d8d93ccd9ea4575544e321c392473ce2d9.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/2e/
-rw-r--r-- root/root 413584 2024-08-25 12:09 ./usr/lib/debug/.build-id/2e/4bc98bde2f0241c530f6287b95cb21eb070ace.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/34/
-rw-r--r-- root/root 15924 2024-08-25 12:09 ./usr/lib/debug/.build-id/34/09046ac3b84849f30b1fe2f2a382c278d97b3e.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/44/
-rw-r--r-- root/root 358716 2024-08-25 12:09 ./usr/lib/debug/.build-id/44/f87cfcf2a934d6a85202f1e75bfb94932cc392.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/45/
-rw-r--r-- root/root 355004 2024-08-25 12:09 ./usr/lib/debug/.build-id/45/07ae65291da00abd17d7172776b4ebaaf13070.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/7a/
-rw-r--r-- root/root 449820 2024-08-25 12:09 ./usr/lib/debug/.build-id/7a/aa17bd1507e32fff7d35b422d848cb3aafb1d5.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/7e/
-rw-r--r-- root/root 436536 2024-08-25 12:09 ./usr/lib/debug/.build-id/7e/4de25570bf33153d9bae8548158afc3cdee347.debug
-rw-r--r-- root/root 412052 2024-08-25 12:09 ./usr/lib/debug/.build-id/7e/7ead858f5c88cf7bede638e54644c82d67eb2a.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/b3/
-rw-r--r-- root/root 403652 2024-08-25 12:09 ./usr/lib/debug/.build-id/b3/162c8298ecd8edbf2a73cab62af11e2d4ede03.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/b9/
-rw-r--r-- root/root 358896 2024-08-25 12:09 ./usr/lib/debug/.build-id/b9/769d0d68b763a3c155ba98f49104eb398f9f99.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/cd/
-rw-r--r-- root/root 439028 2024-08-25 12:09 ./usr/lib/debug/.build-id/cd/4153f758e96461b498e22290476c689b6dce65.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/e8/
-rw-r--r-- root/root 350236 2024-08-25 12:09 ./usr/lib/debug/.build-id/e8/c97b3d9c17a48d0b4302ab6fe62e9d931b69a7.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/f4/
-rw-r--r-- root/root 354316 2024-08-25 12:09 ./usr/lib/debug/.build-id/f4/1a2db3725456e33c94c882e17e9301c0deaa85.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.build-id/fe/
-rw-r--r-- root/root 408296 2024-08-25 12:09 ./usr/lib/debug/.build-id/fe/d7deb75d93daed62d9567e39dfede6b7811b29.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.dwz/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/lib/debug/.dwz/arm-linux-gnueabihf/
-rw-r--r-- root/root 79980 2024-08-25 12:09 ./usr/lib/debug/.dwz/arm-linux-gnueabihf/fasta3.debug
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/doc/
lrwxrwxrwx root/root 0 2024-08-25 12:09 ./usr/share/doc/fasta3-dbgsym -> fasta3
fasta3_36.3.8i.14-Nov-2020-1+b8_armhf.deb
-----------------------------------------
new Debian package, version 2.0.
size 761712 bytes: control archive=5960 bytes.
2219 bytes, 55 lines control
13996 bytes, 189 lines md5sums
Package: fasta3
Source: fasta3 (36.3.8i.14-Nov-2020-1)
Version: 36.3.8i.14-Nov-2020-1+b8
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 5891
Depends: libc6 (>= 2.34), python3
Recommends: r-base-core
Suggests: perl:any, libdbi-perl, libwww-perl, libjson-perl, libhtml-tableextract-perl, libxml-twig-perl, liburi-encode-perl, libdbd-mysql-perl, python3-mysqldb, ncbi-blast+, bedtools
Section: science
Priority: optional
Homepage: https://fasta.bioch.virginia.edu
Description: tools for searching collections of biological sequences
The FASTA programs find regions of local or global similarity between
Protein or DNA sequences, either by searching Protein or DNA databases,
or by identifying local duplications within a sequence. Other
programs provide information on the statistical significance of an
alignment. Like BLAST, FASTA can be used to infer functional and
evolutionary relationships between sequences as well as help identify
members of gene families.
.
* Protein
- Protein-protein FASTA
- Protein-protein Smith-Waterman (ssearch)
- Global Protein-protein (Needleman-Wunsch) (ggsearch)
- Global/Local protein-protein (glsearch)
- Protein-protein with unordered peptides (fasts)
- Protein-protein with mixed peptide sequences (fastf)
.
* Nucleotide
- Nucleotide-Nucleotide (DNA/RNA fasta)
- Ordered Nucleotides vs Nucleotide (fastm)
- Un-ordered Nucleotides vs Nucleotide (fasts)
.
* Translated
- Translated DNA (with frameshifts, e.g. ESTs)
vs Proteins (fastx/fasty)
- Protein vs Translated DNA (with frameshifts)
(tfastx/tfasty)
- Peptides vs Translated DNA (tfasts)
.
* Statistical Significance
- Protein vs Protein shuffle (prss)
- DNA vs DNA shuffle (prss)
- Translated DNA vs Protein shuffle (prfx)
.
* Local Duplications
- Local Protein alignments (lalign)
- Plot Protein alignment "dot-plot" (plalign)
- Local DNA alignments (lalign)
- Plot DNA alignment "dot-plot" (plalign)
.
This software is often used via a web service at the
EBI with readily indexed reference databases at
http://www.ebi.ac.uk/Tools/fasta/.
drwxr-xr-x root/root 0 2024-08-25 12:09 ./
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/bin/
-rwxr-xr-x root/root 334088 2024-08-25 12:09 ./usr/bin/fasta36
-rwxr-xr-x root/root 283412 2024-08-25 12:09 ./usr/bin/fastf36
-rwxr-xr-x root/root 283356 2024-08-25 12:09 ./usr/bin/fastm36
-rwxr-xr-x root/root 283356 2024-08-25 12:09 ./usr/bin/fasts36
-rwxr-xr-x root/root 330064 2024-08-25 12:09 ./usr/bin/fastx36
-rwxr-xr-x root/root 334160 2024-08-25 12:09 ./usr/bin/fasty36
-rwxr-xr-x root/root 378992 2024-08-25 12:09 ./usr/bin/ggsearch36
-rwxr-xr-x root/root 383088 2024-08-25 12:09 ./usr/bin/glsearch36
-rwxr-xr-x root/root 362608 2024-08-25 12:09 ./usr/bin/lalign36
-rwxr-xr-x root/root 9816 2024-08-25 12:09 ./usr/bin/map_db
-rwxr-xr-x root/root 362728 2024-08-25 12:09 ./usr/bin/ssearch36
-rwxr-xr-x root/root 283684 2024-08-25 12:09 ./usr/bin/tfastf36
-rwxr-xr-x root/root 287724 2024-08-25 12:09 ./usr/bin/tfastm36
-rwxr-xr-x root/root 287724 2024-08-25 12:09 ./usr/bin/tfasts36
-rwxr-xr-x root/root 325968 2024-08-25 12:09 ./usr/bin/tfastx36
-rwxr-xr-x root/root 334160 2024-08-25 12:09 ./usr/bin/tfasty36
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/doc/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/doc/fasta3/
-rw-r--r-- root/root 228 2024-08-25 12:09 ./usr/share/doc/fasta3/changelog.Debian.armhf.gz
-rw-r--r-- root/root 1181 2024-08-25 12:09 ./usr/share/doc/fasta3/changelog.Debian.gz
-rw-r--r-- root/root 2874 2022-12-25 18:00 ./usr/share/doc/fasta3/copyright
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/doc/fasta3/examples/
drwxr-xr-x root/root 0 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/
-rw-r--r-- root/root 2528 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/bovgh.seq
-rw-r--r-- root/root 986 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/bovprl.seq
-rw-r--r-- root/root 3159 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/dna_test_s.nlib
-rw-r--r-- root/root 261 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/dyr_human.aa
-rw-r--r-- root/root 1286 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/egmsmg.aa
-rw-r--r-- root/root 806 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/grou_drome.pseg
-rw-r--r-- root/root 18633 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gst.nlib
-rw-r--r-- root/root 1405 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gst.seq
-rw-r--r-- root/root 309 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstm1_human.vaa
-rw-r--r-- root/root 1226 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstm1b_human.nt
-rw-r--r-- root/root 1226 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstm1b_human_fs.nt
-rw-r--r-- root/root 304 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstt1_drome.aa
-rw-r--r-- root/root 311 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gtm1_human.aa
-rw-r--r-- root/root 291 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gtt1_drome.aa
-rw-r--r-- root/root 247 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/h10_human.aa
-rw-r--r-- root/root 225 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/hahu.aa
-rw-r--r-- root/root 7118 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.gcg
-rw-r--r-- root/root 2788 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.seq
-rw-r--r-- root/root 1323 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/humgstd.seq
-rw-r--r-- root/root 271 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/lcbo.aa
-rw-r--r-- root/root 56 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/m1r.aa
-rw-r--r-- root/root 50 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/m2.aa
-rw-r--r-- root/root 189 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mchu.aa
-rw-r--r-- root/root 3440 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.3nt
-rw-r--r-- root/root 342 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.aa
-rw-r--r-- root/root 310 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.aaa
-rw-r--r-- root/root 1220 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.e05
-rw-r--r-- root/root 1122 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.eeq
-rw-r--r-- root/root 1116 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.esq
-rw-r--r-- root/root 406 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.gcg
-rw-r--r-- root/root 282 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.lc
-rw-r--r-- root/root 677 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt
-rw-r--r-- root/root 682 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1
-rw-r--r-- root/root 1352 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt12r
-rw-r--r-- root/root 2033 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13
-rw-r--r-- root/root 2028 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13r
-rw-r--r-- root/root 681 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1r
-rw-r--r-- root/root 160 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nts
-rw-r--r-- root/root 259 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.raa
-rw-r--r-- root/root 1167 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.rev
-rw-r--r-- root/root 1158 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.seq
-rw-r--r-- root/root 148692 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1_genclone.seq
-rw-r--r-- root/root 1286 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgtt2_x.seq
-rw-r--r-- root/root 43 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/ms1.aa
-rw-r--r-- root/root 2361 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mu.lib
-rw-r--r-- root/root 275 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/musplfm.aa
-rw-r--r-- root/root 2047 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mwkw.aa
-rw-r--r-- root/root 500 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mwrtc1.aa
-rw-r--r-- root/root 1294 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/myosin_bp.aa
-rw-r--r-- root/root 27 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n0.aa
-rw-r--r-- root/root 47 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n1.aa
-rw-r--r-- root/root 692 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2.aa
-rw-r--r-- root/root 1482 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2_fs.lib
-rw-r--r-- root/root 178 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2s.aa
-rw-r--r-- root/root 243 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2t.aa
-rw-r--r-- root/root 330 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n_fs.lib
-rw-r--r-- root/root 217 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/ngt.aa
-rw-r--r-- root/root 111 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/ngts.aa
-rw-r--r-- root/root 385 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/oohu.aa
-rw-r--r-- root/root 401 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/oohu.raa
-rw-r--r-- root/root 340 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prio_atepa.aa
-rw-r--r-- root/root 2741 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prot_test.lib
-rw-r--r-- root/root 3391 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prot_test.lseg
-rw-r--r-- root/root 1530 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prot_test_s.lseg
-rw-r--r-- root/root 914 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/qrhuld.aa
-rw-r--r-- root/root 34874 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/titin_hum.aa
-rw-r--r-- root/root 83286 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/titin_hum.seq
-rw-r--r-- root/root 934 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/vav_human.aa
-rw-r--r-- root/root 302 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/xurt8c.aa
-rw-r--r-- root/root 302 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/xurt8c.lc
-rw-r--r-- root/root 281 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/xurtg.aa
drwxr-xr-x root/root 0 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/
-rw-r--r-- root/root 992 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/README
-rw-r--r-- root/root 536 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/create_seq_demo.sql
-rwxr-xr-x root/root 3227 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/join_up50.pl
-rw-r--r-- root/root 347 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/mysql_demo1.sql
-rw-r--r-- root/root 388 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/mysql_demo_pv.sql
-rwxr-xr-x root/root 3300 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/nr_to_sql.pl
-rw-r--r-- root/root 230 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/pirpsd.sql
-rw-r--r-- root/root 317 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/psql_demo.sql
-rw-r--r-- root/root 373 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/psql_demo1.sql
-rw-r--r-- root/root 343 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/psql_demo_pv.sql
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/fasta3/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/fasta3/data/
-rw-r--r-- root/root 2764 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_10.mat
-rw-r--r-- root/root 2548 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_120.mat
-rw-r--r-- root/root 2548 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_160.mat
-rw-r--r-- root/root 2546 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_20.mat
-rw-r--r-- root/root 2548 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_200.mat
-rw-r--r-- root/root 2546 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_40.mat
-rw-r--r-- root/root 2545 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_80.mat
-rw-r--r-- root/root 1922 2022-11-14 21:42 ./usr/share/fasta3/data/blosum45.mat
-rw-r--r-- root/root 1921 2022-11-14 21:42 ./usr/share/fasta3/data/blosum50.mat
-rw-r--r-- root/root 1922 2022-11-14 21:42 ./usr/share/fasta3/data/blosum62.mat
-rw-r--r-- root/root 1924 2022-11-14 21:42 ./usr/share/fasta3/data/blosum80.mat
-rw-r--r-- root/root 976 2022-11-14 21:42 ./usr/share/fasta3/data/dna.mat
-rw-r--r-- root/root 2256 2022-11-14 21:42 ./usr/share/fasta3/data/idn_aa.mat
-rw-r--r-- root/root 2255 2022-11-14 21:42 ./usr/share/fasta3/data/md_10.mat
-rw-r--r-- root/root 2256 2022-11-14 21:42 ./usr/share/fasta3/data/md_20.mat
-rw-r--r-- root/root 2255 2022-11-14 21:42 ./usr/share/fasta3/data/md_40.mat
-rw-r--r-- root/root 1922 2022-11-14 21:42 ./usr/share/fasta3/data/pam120.mat
-rw-r--r-- root/root 1923 2022-11-14 21:42 ./usr/share/fasta3/data/pam250.mat
-rw-r--r-- root/root 998 2022-11-14 21:42 ./usr/share/fasta3/data/rna.mat
-rw-r--r-- root/root 2771 2022-11-14 21:42 ./usr/share/fasta3/data/vtml160.mat
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/fasta3/misc/
-rw-r--r-- root/root 424 2022-11-14 21:42 ./usr/share/fasta3/misc/README
-rwxr-xr-x root/root 3447 2022-11-14 21:42 ./usr/share/fasta3/misc/parse_m9.pl
-rwxr-xr-x root/root 367 2022-11-14 21:42 ./usr/share/fasta3/misc/res2R.pl
-rwxr-xr-x root/root 3177 2022-11-14 21:42 ./usr/share/fasta3/misc/shuffle_embed.pl
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/fasta3/scripts/
-rw-r--r-- root/root 5789 2022-11-14 21:42 ./usr/share/fasta3/scripts/README
-rw-r--r-- root/root 3182 2022-11-14 21:42 ./usr/share/fasta3/scripts/README.scripts
-rw-r--r-- root/root 76 2022-11-14 21:42 ./usr/share/fasta3/scripts/acc_examples
-rwxr-xr-x root/root 12539 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_exons_all.pl
-rwxr-xr-x root/root 7233 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_exons_ens.pl
-rwxr-xr-x root/root 4941 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_exons_ncbi.pl
-rwxr-xr-x root/root 8535 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_exons_up_sql.pl
-rwxr-xr-x root/root 12227 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_exons_up_sql_www.pl
-rwxr-xr-x root/root 9106 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_exons_up_www.pl
-rwxr-xr-x root/root 15933 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_feats2ipr.pl
-rwxr-xr-x root/root 15996 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_feats2ipr_e.pl
-rwxr-xr-x root/root 13524 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_feats_up_sql.pl
-rwxr-xr-x root/root 12846 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_feats_up_www2.pl
-rwxr-xr-x root/root 14551 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_ipr_www.pl
-rwxr-xr-x root/root 9521 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_pdb_cath.pl
-rwxr-xr-x root/root 8406 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_pdb_vast.pl
-rwxr-xr-x root/root 24113 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_pfam28.pl
-rwxr-xr-x root/root 27702 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_pfam30_tmptbl.pl
-rwxr-xr-x root/root 27278 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_pfam_sql.pl
-rwxr-xr-x root/root 8244 2022-11-14 21:42 ./usr/share/fasta3/scripts/ann_pfam_sql.py
-rwxr-xr-x root/root 20591 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_pfam_www.pl
-rwxr-xr-x root/root 7871 2022-11-14 21:42 ./usr/share/fasta3/scripts/ann_pfam_www.py
-rw-r--r-- root/root 321 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_script_list
-rwxr-xr-x root/root 23659 2024-08-25 12:09 ./usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl
-rwxr-xr-x root/root 44912 2024-08-25 12:09 ./usr/share/fasta3/scripts/annot_blast_btop2.pl
-rwxr-xr-x root/root 25321 2024-08-25 12:09 ./usr/share/fasta3/scripts/annot_blast_btop3.py
-rwxr-xr-x root/root 27067 2024-08-25 12:09 ./usr/share/fasta3/scripts/annot_blast_btop4.py
-rwxr-xr-x root/root 3017 2024-08-25 12:09 ./usr/share/fasta3/scripts/blastp_annot_cmd.sh
-rwxr-xr-x root/root 753 2024-08-25 12:09 ./usr/share/fasta3/scripts/blastp_cmd.sh
-rwxr-xr-x root/root 4583 2022-11-14 21:42 ./usr/share/fasta3/scripts/color_defs.pl
-rwxr-xr-x root/root 4564 2024-08-25 12:09 ./usr/share/fasta3/scripts/exp_up_ensg.pl
-rwxr-xr-x root/root 3275 2024-08-25 12:09 ./usr/share/fasta3/scripts/expand_links.pl
-rwxr-xr-x root/root 5572 2024-08-25 12:09 ./usr/share/fasta3/scripts/expand_refseq_isoforms.pl
-rwxr-xr-x root/root 2576 2024-08-25 12:09 ./usr/share/fasta3/scripts/expand_uniref50.pl
-rwxr-xr-x root/root 6043 2024-08-25 12:09 ./usr/share/fasta3/scripts/expand_up_isoforms.pl
-rwxr-xr-x root/root 1590 2024-08-25 12:09 ./usr/share/fasta3/scripts/fasta_annot_cmd.sh
-rwxr-xr-x root/root 1676 2024-08-25 12:09 ./usr/share/fasta3/scripts/get_genome_seq.py
-rwxr-xr-x root/root 1669 2024-08-25 12:09 ./usr/share/fasta3/scripts/get_protein.py
-rwxr-xr-x root/root 1722 2024-08-25 12:09 ./usr/share/fasta3/scripts/get_protein_sql.py
-rwxr-xr-x root/root 3659 2024-08-25 12:09 ./usr/share/fasta3/scripts/get_protein_sql_www.py
-rwxr-xr-x root/root 553 2024-08-25 12:09 ./usr/share/fasta3/scripts/get_refseq.py
-rwxr-xr-x root/root 409 2024-08-25 12:09 ./usr/share/fasta3/scripts/get_uniprot.py
-rwxr-xr-x root/root 1188 2024-08-25 12:09 ./usr/share/fasta3/scripts/get_up_prot_iso_sql.py
-rwxr-xr-x root/root 9405 2024-08-25 12:09 ./usr/share/fasta3/scripts/lav2plt.pl
-rwxr-xr-x root/root 15015 2024-08-25 12:09 ./usr/share/fasta3/scripts/lavplt_ps.pl
-rwxr-xr-x root/root 13106 2024-08-25 12:09 ./usr/share/fasta3/scripts/lavplt_svg.pl
-rwxr-xr-x root/root 1909 2024-08-25 12:09 ./usr/share/fasta3/scripts/links2sql.pl
-rwxr-xr-x root/root 9771 2022-11-14 21:42 ./usr/share/fasta3/scripts/m8CBl_to_plot2.R
-rwxr-xr-x root/root 11092 2024-08-25 12:09 ./usr/share/fasta3/scripts/m8_btop_msa.pl
-rwxr-xr-x root/root 18926 2024-08-25 12:09 ./usr/share/fasta3/scripts/m9B_btop_msa.pl
-rwxr-xr-x root/root 16976 2024-08-25 12:09 ./usr/share/fasta3/scripts/map_exon_coords.py
-rwxr-xr-x root/root 7659 2024-08-25 12:09 ./usr/share/fasta3/scripts/merge_blast_btab.pl
-rwxr-xr-x root/root 9415 2024-08-25 12:09 ./usr/share/fasta3/scripts/merge_fasta_btab.pl
-rwxr-xr-x root/root 19093 2022-11-14 21:42 ./usr/share/fasta3/scripts/plot_domain2t.cgi
-rwxr-xr-x root/root 5286 2024-08-25 12:09 ./usr/share/fasta3/scripts/relabel_domains.py
-rwxr-xr-x root/root 30354 2024-08-25 12:09 ./usr/share/fasta3/scripts/rename_exons.py
-rwxr-xr-x root/root 3042 2024-08-25 12:09 ./usr/share/fasta3/scripts/summ_domain_ident.pl
-rwxr-xr-x root/root 706 2024-08-25 12:09 ./usr/share/fasta3/scripts/test_ann_scripts.sh
-rwxr-xr-x root/root 2978 2024-08-25 12:09 ./usr/share/fasta3/scripts/test_py.sh
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/man/
drwxr-xr-x root/root 0 2024-08-25 12:09 ./usr/share/man/man1/
-rw-r--r-- root/root 7358 2024-08-25 12:09 ./usr/share/man/man1/fasta36.1.gz
-rw-r--r-- root/root 2195 2024-08-25 12:09 ./usr/share/man/man1/fastf3.1.gz
-rw-r--r-- root/root 2119 2024-08-25 12:09 ./usr/share/man/man1/fasts3.1.gz
-rw-r--r-- root/root 523 2024-08-25 12:09 ./usr/share/man/man1/map_db.1.gz
-rw-r--r-- root/root 2146 2024-08-25 12:09 ./usr/share/man/man1/prss3.1.gz
-rw-r--r-- root/root 402 2024-08-25 12:09 ./usr/share/man/man1/ps_lav.1.gz
+------------------------------------------------------------------------------+
| Post Build |
+------------------------------------------------------------------------------+
+------------------------------------------------------------------------------+
| Cleanup |
+------------------------------------------------------------------------------+
Purging /<<BUILDDIR>>
Not cleaning session: cloned chroot in use
+------------------------------------------------------------------------------+
| Summary |
+------------------------------------------------------------------------------+
Build Architecture: armhf
Build Type: any
Build-Space: 56080
Build-Time: 325
Distribution: trixie-staging
Host Architecture: armhf
Install-Time: 5
Job: fasta3_36.3.8i.14-Nov-2020-1
Machine Architecture: arm64
Package: fasta3
Package-Time: 339
Source-Version: 36.3.8i.14-Nov-2020-1
Space: 56080
Status: successful
Version: 36.3.8i.14-Nov-2020-1+b8
--------------------------------------------------------------------------------
Finished at 2024-08-25T12:15:05Z
Build needed 00:05:39, 56080k disk space