Raspbian Package Auto-Building

Build log for fasta3 (36.3.8i.14-Nov-2020-1+b6) on armhf

fasta336.3.8i.14-Nov-2020-1+b6armhf → 2024-05-21 04:36:40

sbuild (Debian sbuild) 0.85.0 (04 January 2023) on test2023

+==============================================================================+
| fasta3 36.3.8i.14-Nov-2020-1+b6 (armhf)      Tue, 21 May 2024 04:15:01 +0000 |
+==============================================================================+

Package: fasta3
Version: 36.3.8i.14-Nov-2020-1+b6
Source Version: 36.3.8i.14-Nov-2020-1
Distribution: trixie-staging
Machine Architecture: arm64
Host Architecture: armhf
Build Architecture: armhf
Build Type: any

I: NOTICE: Log filtering will replace 'var/run/schroot/mount/trixie-staging-armhf-sbuild-b0d9690d-a8b9-49b4-b71e-7f88d55c2de4' with '<<CHROOT>>'
I: NOTICE: Log filtering will replace 'build/fasta3-I69MsO/resolver-q1vrH4' with '<<RESOLVERDIR>>'

+------------------------------------------------------------------------------+
| Update chroot                                                                |
+------------------------------------------------------------------------------+

Get:1 http://172.17.4.1/private trixie-staging InRelease [11.3 kB]
Get:2 http://172.17.4.1/private trixie-staging/main armhf Packages [15.2 MB]
Fetched 15.3 MB in 4s (4071 kB/s)
Reading package lists...
W: http://172.17.4.1/private/dists/trixie-staging/InRelease: Key is stored in legacy trusted.gpg keyring (/etc/apt/trusted.gpg), see the DEPRECATION section in apt-key(8) for details.

+------------------------------------------------------------------------------+
| Fetch source files                                                           |
+------------------------------------------------------------------------------+


Check APT
---------

Checking available source versions...

Download source files with APT
------------------------------

Reading package lists...
NOTICE: 'fasta3' packaging is maintained in the 'Git' version control system at:
https://salsa.debian.org/med-team/fasta3.git
Please use:
git clone https://salsa.debian.org/med-team/fasta3.git
to retrieve the latest (possibly unreleased) updates to the package.
Need to get 1416 kB of source archives.
Get:1 http://172.17.4.1/private trixie-staging/main fasta3 36.3.8i.14-Nov-2020-1 (dsc) [2224 B]
Get:2 http://172.17.4.1/private trixie-staging/main fasta3 36.3.8i.14-Nov-2020-1 (tar) [1403 kB]
Get:3 http://172.17.4.1/private trixie-staging/main fasta3 36.3.8i.14-Nov-2020-1 (diff) [10.8 kB]
Fetched 1416 kB in 1s (1862 kB/s)
Download complete and in download only mode
I: NOTICE: Log filtering will replace 'build/fasta3-I69MsO/fasta3-36.3.8i.14-Nov-2020' with '<<PKGBUILDDIR>>'
I: NOTICE: Log filtering will replace 'build/fasta3-I69MsO' with '<<BUILDDIR>>'

+------------------------------------------------------------------------------+
| Install package build dependencies                                           |
+------------------------------------------------------------------------------+


Setup apt archive
-----------------

Merged Build-Depends: debhelper-compat (= 13), libsimde-dev, build-essential, fakeroot
Filtered Build-Depends: debhelper-compat (= 13), libsimde-dev, build-essential, fakeroot
dpkg-deb: building package 'sbuild-build-depends-main-dummy' in '/<<RESOLVERDIR>>/apt_archive/sbuild-build-depends-main-dummy.deb'.
Ign:1 copy:/<<RESOLVERDIR>>/apt_archive ./ InRelease
Get:2 copy:/<<RESOLVERDIR>>/apt_archive ./ Release [609 B]
Ign:3 copy:/<<RESOLVERDIR>>/apt_archive ./ Release.gpg
Get:4 copy:/<<RESOLVERDIR>>/apt_archive ./ Sources [631 B]
Get:5 copy:/<<RESOLVERDIR>>/apt_archive ./ Packages [663 B]
Fetched 1903 B in 0s (0 B/s)
Reading package lists...
Reading package lists...

Install main build dependencies (apt-based resolver)
----------------------------------------------------

Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
  libalgorithm-diff-perl libalgorithm-merge-perl libarchive-cpio-perl
  libltdl-dev libltdl7 libmail-sendmail-perl libnumber-compare-perl
  libsys-hostname-long-perl libtext-glob-perl netbase
Use 'apt autoremove' to remove them.
The following additional packages will be installed:
  libsimde-dev
The following NEW packages will be installed:
  libsimde-dev sbuild-build-depends-main-dummy
0 upgraded, 2 newly installed, 0 to remove and 0 not upgraded.
Need to get 466 kB of archives.
After this operation, 8551 kB of additional disk space will be used.
Get:1 copy:/<<RESOLVERDIR>>/apt_archive ./ sbuild-build-depends-main-dummy 0.invalid.0 [880 B]
Get:2 http://172.17.4.1/private trixie-staging/main armhf libsimde-dev all 0.8.2-1 [465 kB]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 466 kB in 0s (1208 kB/s)
Selecting previously unselected package libsimde-dev.
(Reading database ... 14693 files and directories currently installed.)
Preparing to unpack .../libsimde-dev_0.8.2-1_all.deb ...
Unpacking libsimde-dev (0.8.2-1) ...
Selecting previously unselected package sbuild-build-depends-main-dummy.
Preparing to unpack .../sbuild-build-depends-main-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-main-dummy (0.invalid.0) ...
Setting up libsimde-dev (0.8.2-1) ...
Setting up sbuild-build-depends-main-dummy (0.invalid.0) ...

+------------------------------------------------------------------------------+
| Check architectures                                                          |
+------------------------------------------------------------------------------+

Arch check ok (armhf included in any all)

+------------------------------------------------------------------------------+
| Build environment                                                            |
+------------------------------------------------------------------------------+

Kernel: Linux 6.1.47-v8+ #1 SMP PREEMPT Fri Sep  1 07:05:33 BST 2023 arm64 (aarch64)
Toolchain package versions: binutils_2.41-6+rpi1+b1 dpkg-dev_1.22.5+rpi1 g++-12_12.3.0-14+rpi1 g++-13_13.2.0-16.1+rpi1 gcc-12_12.3.0-14+rpi1 gcc-13_13.2.0-16.1+rpi1 libc6-dev_2.38-8+rpi1 libstdc++-12-dev_12.3.0-14+rpi1 libstdc++-13-dev_13.2.0-16.1+rpi1 libstdc++6_14-20240221-2.1+rpi1 linux-libc-dev_6.5.6-1+rpi1+b1
Package versions: adduser_3.137 apt_2.9.3 autoconf_2.71-3 automake_1:1.16.5-1.3 autopoint_0.21-14 autotools-dev_20220109.1 base-files_13+rpi1 base-passwd_3.6.3 bash_5.2.21-2 binutils_2.41-6+rpi1+b1 binutils-arm-linux-gnueabihf_2.41-6+rpi1+b1 binutils-common_2.41-6+rpi1+b1 bsdextrautils_2.40.1-1 bsdutils_1:2.40.1-1 build-essential_12.10 bzip2_1.0.8-5.1 coreutils_9.4-3.1 cpp_4:13.2.0-1+rpi1 cpp-12_12.3.0-14+rpi1 cpp-13_13.2.0-16.1+rpi1 cpp-13-arm-linux-gnueabihf_13.2.0-16.1+rpi1 dash_0.5.12-6 debconf_1.5.86 debhelper_13.15.3 debianutils_5.17 dh-autoreconf_20 dh-strip-nondeterminism_1.13.1-1 diffutils_1:3.10-1 dirmngr_2.2.40-3 dpkg_1.22.5+rpi1 dpkg-dev_1.22.5+rpi1 dwz_0.15-1+b2 e2fsprogs_1.47.1~rc2-1 fakeroot_1.33-1 file_1:5.45-3 findutils_4.9.0-5 g++_4:13.2.0-1+rpi1 g++-12_12.3.0-14+rpi1 g++-13_13.2.0-16.1+rpi1 g++-13-arm-linux-gnueabihf_13.2.0-16.1+rpi1 gcc_4:13.2.0-1+rpi1 gcc-10-base_10.4.0-7+rpi1 gcc-12_12.3.0-14+rpi1 gcc-12-base_12.3.0-14+rpi1 gcc-13_13.2.0-16.1+rpi1 gcc-13-arm-linux-gnueabihf_13.2.0-16.1+rpi1 gcc-13-base_13.2.0-16.1+rpi1 gcc-14-base_14-20240221-2.1+rpi1 gcc-7-base_7.5.0-6+rpi1+b2 gcc-8-base_8.4.0-7+rpi1 gcc-9-base_9.4.0-2+rpi1 gettext_0.21-14 gettext-base_0.21-14 gnupg_2.2.40-3 gnupg-l10n_2.2.40-3 gnupg-utils_2.2.40-3 gpg_2.2.40-3 gpg-agent_2.2.40-3 gpg-wks-client_2.2.40-3 gpg-wks-server_2.2.40-3 gpgconf_2.2.40-3 gpgsm_2.2.40-3 gpgv_2.2.40-3 grep_3.11-4 groff-base_1.23.0-3 gzip_1.12-1.1 hostname_3.23+nmu2 init-system-helpers_1.66 intltool-debian_0.35.0+20060710.6 libacl1_2.3.2-2+rpi1 libalgorithm-diff-perl_1.201-1 libalgorithm-merge-perl_0.08-5 libapt-pkg6.0t64_2.9.3 libarchive-cpio-perl_0.10-3 libarchive-zip-perl_1.68-1 libasan8_14-20240221-2.1+rpi1 libassuan0_2.5.6-1 libatomic1_14-20240221-2.1+rpi1 libattr1_1:2.5.2-1 libaudit-common_1:3.1.2-2 libaudit1_1:3.1.2-2 libbinutils_2.41-6+rpi1+b1 libblkid1_2.40.1-1 libbz2-1.0_1.0.8-5.1 libc-bin_2.38-8+rpi1 libc-dev-bin_2.38-8+rpi1 libc6_2.38-8+rpi1 libc6-dev_2.38-8+rpi1 libcap-ng0_0.8.5-1 libcap2_1:2.66-5 libcc1-0_14-20240221-2.1+rpi1 libcom-err2_1.47.1~rc2-1 libcrypt-dev_1:4.4.36-4 libcrypt1_1:4.4.36-4 libctf-nobfd0_2.41-6+rpi1+b1 libctf0_2.41-6+rpi1+b1 libdata-optlist-perl_0.114-1 libdb5.3t64_5.3.28+dfsg2-7 libdebconfclient0_0.271 libdebhelper-perl_13.15.3 libdpkg-perl_1.22.5+rpi1 libelf1t64_0.191-1+rpi1 libext2fs2t64_1.47.1~rc2-1 libfakeroot_1.33-1 libffi8_3.4.6-1 libfile-stripnondeterminism-perl_1.13.1-1 libgcc-12-dev_12.3.0-14+rpi1 libgcc-13-dev_13.2.0-16.1+rpi1 libgcc-s1_14-20240221-2.1+rpi1 libgcrypt20_1.10.3-3 libgdbm-compat4t64_1.23-5.1+b1 libgdbm6t64_1.23-5.1+b1 libgmp10_2:6.3.0+dfsg-2 libgnutls30t64_3.8.5-2 libgomp1_14-20240221-2.1+rpi1 libgpg-error0_1.49-2 libhogweed6t64_3.9.1-2.2 libicu72_72.1-4+b1 libidn2-0_2.3.7-2 libisl23_0.26-3 libjansson4_2.14-2 libk5crypto3_1.20.1-6 libkeyutils1_1.6.3-3 libkrb5support0_1.20.1-6 libksba8_1.6.6-1 libldap-2.5-0_2.5.17+dfsg-1 libltdl-dev_2.4.7-7+b1 libltdl7_2.4.7-7+b1 liblz4-1_1.9.4-1+rpi1+b2 liblzma5_5.6.1+really5.4.5-1 libmagic-mgc_1:5.45-3 libmagic1t64_1:5.45-3 libmail-sendmail-perl_0.80-3 libmd0_1.1.0-2 libmount1_2.40.1-1 libmpc3_1.3.1-1 libmpfr6_4.2.1-1 libncursesw6_6.5-2 libnettle8t64_3.9.1-2.2 libnpth0t64_1.6-3.1 libnumber-compare-perl_0.03-3 libp11-kit0_0.25.3-5 libpam-modules_1.5.3-7 libpam-modules-bin_1.5.3-7 libpam-runtime_1.5.3-7 libpam0g_1.5.3-7 libparams-util-perl_1.102-3 libpcre2-8-0_10.42-4+b1 libperl5.38t64_5.38.2-4 libpipeline1_1.5.7-2 libreadline8t64_8.2-4 libsasl2-2_2.1.28+dfsg1-6 libsasl2-modules-db_2.1.28+dfsg1-6 libseccomp2_2.5.5-1+rpi1 libselinux1_3.5-2+b2 libsemanage-common_3.5-1 libsemanage2_3.5-1 libsepol2_3.5-2+b1 libsframe1_2.41-6+rpi1+b1 libsimde-dev_0.8.2-1 libsmartcols1_2.40.1-1 libsqlite3-0_3.45.1-1 libss2_1.47.1~rc2-1 libssl3t64_3.2.1-3 libstdc++-12-dev_12.3.0-14+rpi1 libstdc++-13-dev_13.2.0-16.1+rpi1 libstdc++6_14-20240221-2.1+rpi1 libsub-exporter-perl_0.990-1 libsub-install-perl_0.929-1 libsub-override-perl_0.11-1 libsub-prototype-perl_0.03-2+b2 libsys-hostname-long-perl_1.5-3 libsystemd0_255.3-1+rpi1+b1 libtasn1-6_4.19.0-3+b2 libtext-glob-perl_0.11-3 libtinfo6_6.5-2 libtirpc-common_1.3.4+ds-1.3 libtool_2.4.7-7 libubsan1_14-20240221-2.1+rpi1 libuchardet0_0.0.8-1 libudev1_255.3-1+rpi1+b1 libunistring5_1.2-1 libuuid1_2.40.1-1 libxml2_2.9.14+dfsg-1.3+b4 libxxhash0_0.8.2-2+b1 libzstd1_1.5.5+dfsg2-2 linux-libc-dev_6.5.6-1+rpi1+b1 login_1:4.13+dfsg1-4 logsave_1.47.1~rc2-1 lsb-base_11.6+rpi1 m4_1.4.19-4 make_4.3-4.1 man-db_2.12.1-1 mawk_1.3.4.20240123-1 mount_2.40.1-1 nano_8.0-1 ncurses-base_6.5-2 ncurses-bin_6.5-2 netbase_6.4 passwd_1:4.13+dfsg1-4 patch_2.7.6-7 perl_5.38.2-4 perl-base_5.38.2-4 perl-modules-5.38_5.38.2-4 pinentry-curses_1.2.1-3 po-debconf_1.0.21+nmu1 raspbian-archive-keyring_20120528.2 readline-common_8.2-4 rpcsvc-proto_1.4.3-1 sbuild-build-depends-main-dummy_0.invalid.0 sed_4.9-2 sensible-utils_0.0.22 sysvinit-utils_3.09-1 tar_1.35+dfsg-3 tzdata_2024a-4 usr-is-merged_39 util-linux_2.40.1-1 xz-utils_5.6.1+really5.4.5-1 zlib1g_1:1.3.dfsg+really1.3.1-1

+------------------------------------------------------------------------------+
| Build                                                                        |
+------------------------------------------------------------------------------+


Unpack source
-------------

-----BEGIN PGP SIGNED MESSAGE-----
Hash: SHA256

Format: 3.0 (quilt)
Source: fasta3
Binary: fasta3, fasta3-doc
Architecture: any all
Version: 36.3.8i.14-Nov-2020-1
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Uploaders: Steffen Moeller <moeller@debian.org>
Homepage: https://fasta.bioch.virginia.edu
Standards-Version: 4.6.2
Vcs-Browser: https://salsa.debian.org/med-team/fasta3
Vcs-Git: https://salsa.debian.org/med-team/fasta3.git
Testsuite: autopkgtest
Testsuite-Triggers: libdbd-mysql-perl, libdbi-perl, libjson-perl, libwww-perl, libxml-twig-perl, python3-mysqldb
Build-Depends: debhelper-compat (= 13), libsimde-dev
Package-List:
 fasta3 deb science optional arch=any
 fasta3-doc deb doc optional arch=all
Checksums-Sha1:
 3469c4307c05081a8bccb647e7d1d9dea0aaf92f 1402674 fasta3_36.3.8i.14-Nov-2020.orig.tar.gz
 f7ca0324189992dafe292be375194e88b05bf818 10796 fasta3_36.3.8i.14-Nov-2020-1.debian.tar.xz
Checksums-Sha256:
 b4b1c3c9be6beebcbaf4215368e159d69255e34c0bdbc84affa10cdb473ce008 1402674 fasta3_36.3.8i.14-Nov-2020.orig.tar.gz
 ae0f5b50b1ffecddbf8fc15bc76ad16c9098416a7d6efb98b824b4b26ab210b8 10796 fasta3_36.3.8i.14-Nov-2020-1.debian.tar.xz
Files:
 406264dbafe9b5f4426eee5cc3ffcd25 1402674 fasta3_36.3.8i.14-Nov-2020.orig.tar.gz
 a04a9c2a9665878d5a9bd88576429db4 10796 fasta3_36.3.8i.14-Nov-2020-1.debian.tar.xz

-----BEGIN PGP SIGNATURE-----

iQJFBAEBCAAvFiEE8fAHMgoDVUHwpmPKV4oElNHGRtEFAmOolZwRHHRpbGxlQGRl
Ymlhbi5vcmcACgkQV4oElNHGRtEVYBAAjHbg9P0Lz4u4x+aPpW4Iw6gelkT8uh7z
G1WbLQLvvce0KB4zvKaJfu3tbyKwL83DruJ9TV2+tqkF4vBii2E0XL7G3+7xE6pV
MIPAnKo0gsNF4ktnBEfkEaYrp/e/ybdxeY0HSnaHC++9dIkNRr9e+HxhQxcGMIPV
/QpKwCI8lqkiwnAhGCxK4rjVW1Bk4hKNcUKRa+j/9/DOMNGHlRQoMlzmwCk5ucp9
AdtA8X7g/hEoAaGXkiBoSbAzT/OYL4RKB31pcOeS6DIeRwOuAwZJpXr/L6ifY0n5
d7iimMMZp+9UQsRhsW8HiNR2ZiBF1+I7Tij4OUe80WRIIGyDIEWhlHuCEHNsAa1I
IZMfMpJFKvtqZNfHUCtybstbIEQau5Hmfa35LdXR8I866xZ3upDl9iRFxi7LHkyK
Wlk2T/gF1ila3Bj+3dJVHnMU6xB3Mb9/Xr7nLyBu/Mq4RSo4d+qCy0uNvuGncxCK
1WbnatLEVlakQgeRuz5BhsHWk3vZ6GAPqAB9EB1v2At/mUuCvEApFnTFP96IBy9r
vsAnXNnKKNxWl1M5L1A+ySEod6AV7+G/jVMgeF1tkzznR/jKERjbFLeCXtEArt8v
MiZMO0hs3MLAyjyzif9y+WJH1CJ4MNkLKNTOd9w/ERmVS4D2UfZNQO3MNRa+BeMN
Ni7qj0r/qKo=
=HNE5
-----END PGP SIGNATURE-----

gpgv: Signature made Sun Dec 25 18:25:32 2022 UTC
gpgv:                using RSA key F1F007320A035541F0A663CA578A0494D1C646D1
gpgv:                issuer "tille@debian.org"
gpgv: Can't check signature: No public key
dpkg-source: warning: cannot verify inline signature for ./fasta3_36.3.8i.14-Nov-2020-1.dsc: no acceptable signature found
dpkg-source: info: extracting fasta3 in /<<PKGBUILDDIR>>
dpkg-source: info: unpacking fasta3_36.3.8i.14-Nov-2020.orig.tar.gz
dpkg-source: info: unpacking fasta3_36.3.8i.14-Nov-2020-1.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying Makefile.patch
dpkg-source: info: applying local_tests
dpkg-source: info: applying adjust-scripts

Check disk space
----------------

Sufficient free space for build

Hack binNMU version
-------------------

Created changelog entry for binNMU version 36.3.8i.14-Nov-2020-1+b6

User Environment
----------------

APT_CONFIG=/var/lib/sbuild/apt.conf
DEB_BUILD_OPTIONS=parallel=4
HOME=/sbuild-nonexistent
LANG=en_GB.UTF-8
LC_ALL=C.UTF-8
LOGNAME=buildd
PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games
SCHROOT_ALIAS_NAME=trixie-staging-armhf-sbuild
SCHROOT_CHROOT_NAME=trixie-staging-armhf-sbuild
SCHROOT_COMMAND=env
SCHROOT_GID=124
SCHROOT_GROUP=buildd
SCHROOT_SESSION_ID=trixie-staging-armhf-sbuild-b0d9690d-a8b9-49b4-b71e-7f88d55c2de4
SCHROOT_UID=114
SCHROOT_USER=buildd
SHELL=/bin/sh
USER=buildd

dpkg-buildpackage
-----------------

Command: dpkg-buildpackage --sanitize-env -us -uc -mRaspbian pi5 test autobuilder <root@raspbian.org> -B -rfakeroot
dpkg-buildpackage: info: source package fasta3
dpkg-buildpackage: info: source version 36.3.8i.14-Nov-2020-1+b6
dpkg-buildpackage: info: source distribution trixie-staging
 dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
 debian/rules clean
dh clean --sourcedirectory src
   debian/rules override_dh_auto_clean
make[1]: Entering directory '/<<PKGBUILDDIR>>'
if [ -d src ]; then cd src && /usr/bin/make -f "../make/Makefile.linux64" clean-up; fi
make[2]: Entering directory '/<<PKGBUILDDIR>>/src'
rm -f *.o  fasta36 ssearch36 lalign36 fasts36 fastx36 tfastx36 fasty36 tfasty36 tfasts36 fastm36 tfastm36 fastf36 tfastf36 glsearch36 ggsearch36 map_db; 	rm -rf ../bin/*
make[2]: Leaving directory '/<<PKGBUILDDIR>>/src'
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   dh_autoreconf_clean -O--sourcedirectory=src
   dh_clean -O--sourcedirectory=src
 debian/rules binary-arch
dh binary-arch --sourcedirectory src
   dh_update_autotools_config -a -O--sourcedirectory=src
   dh_autoreconf -a -O--sourcedirectory=src
   dh_auto_configure -a -O--sourcedirectory=src
   debian/rules override_dh_auto_build
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_build --sourcedirectory make --builddirectory src --buildsystem makefile -- -f "../make/Makefile.linux64"
	cd src && make -j4 "INSTALL=install --strip-program=true" -f ../make/Makefile.linux64
make[2]: Entering directory '/<<PKGBUILDDIR>>/src'
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DCOMP_THR -DCOMP_MLIB -c comp_lib9.c -o comp_mthr9.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c work_thr2.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c pthr_subs2.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DCOMP_THR  -DCOMP_MLIB -c compacc2e.c -o compacc2_t.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c mshowbest.c -o showbest.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c build_ares.c -o build_ares.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c re_getlib.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DCOMP_THR -c mshowalign2.c -o mshowalign2_t.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c htime.c
mshowalign2.c: In function ‘showalign’:
mshowalign2.c:617:64: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
  617 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                              ~~^
      |                                                                |
      |                                                                long unsigned int
      |                                                              %u
  618 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                         ~~~~~~~~~~~~~                           
      |                         |
      |                         size_t {aka unsigned int}
mshowalign2.c:617:68: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
  617 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                                  ~~^
      |                                                                    |
      |                                                                    long unsigned int
      |                                                                  %u
  618 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                                       ~~~~~~~~~~~~~                 
      |                                       |
      |                                       size_t {aka unsigned int}
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c apam.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c doinit.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTA initfa.c -o init_fa.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DLOCAL_SCORE -c scaleswn.c -o scale_se.o
scaleswn.c: In function ‘process_hist’:
scaleswn.c:255:55: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
  255 |       fprintf(stderr," cannot allocate pstat_union: %ld\n",sizeof(struct pstat_str));
      |                                                     ~~^    ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                       |    |
      |                                                       |    unsigned int
      |                                                       long int
      |                                                     %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c karlin.c
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c dropnfa.c -o drop_nfa.o
dropnfa.c: In function ‘init_work’:
dropnfa.c:306:77: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
  306 |     fprintf (stderr,"*** ERROR [%s:%d] - cannot allocate diagonal arrays: %lu\n",
      |                                                                           ~~^
      |                                                                             |
      |                                                                             long unsigned int
      |                                                                           %u
cc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2  -c -o wm_align.o wm_align.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTA -c cal_cons2.c -o calcons_fa.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c nmgetlib.c -o lgetlib.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c mmgetaa.c -o lgetaa_m.o
nmgetlib.c: In function ‘open_lib’:
nmgetlib.c:414:76: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
  414 |         fprintf(stderr,"\n*** Warning [%s:%d] - cannot allocate lmf_str (%ld) for %s\n",
      |                                                                          ~~^
      |                                                                            |
      |                                                                            long int
      |                                                                          %d
  415 |                 __FILE__, __LINE__,sizeof(struct lmf_str),lib_p->file_name);
      |                                    ~~~~~~~~~~~~~~~~~~~~~~                   
      |                                    |
      |                                    unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c c_dispn.c
nmgetlib.c: In function ‘sel_hacc_libstr_init’:
nmgetlib.c:2025:71: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2025 |     fprintf(stderr, "*** Warning [%s:%d] - cannot allocate acc_hash[%ld]\n",__FILE__, __LINE__,hash_max*sizeof(int));
      |                                                                     ~~^                        ~~~~~~~~~~~~~~~~~~~~
      |                                                                       |                                |
      |                                                                       long int                         unsigned int
      |                                                                     %d
nmgetlib.c:2031:76: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2031 |     fprintf(stderr, "*** Warning [%s:%d] - cannot allocate acc_hash_link[%ld]\n",__FILE__, __LINE__,acc_cnt*sizeof(char *));
      |                                                                          ~~^                        ~~~~~~~~~~~~~~~~~~~~~~
      |                                                                            |                               |
      |                                                                            long int                        unsigned int
      |                                                                          %d
nmgetlib.c: In function ‘sel_hacc_gi_init’:
nmgetlib.c:2152:70: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2152 |     fprintf(stderr, "*** Warning [%s:%d] - cannot allocate gi_hash[%ld]\n",__FILE__, __LINE__,hash_max*sizeof(int));
      |                                                                    ~~^                        ~~~~~~~~~~~~~~~~~~~~
      |                                                                      |                                |
      |                                                                      long int                         unsigned int
      |                                                                    %d
nmgetlib.c:2158:75: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2158 |     fprintf(stderr, "*** Warning [%s:%d] - cannot allocate gi_hash_link[%ld]\n",__FILE__, __LINE__,acc_cnt*sizeof(char *));
      |                                                                         ~~^                        ~~~~~~~~~~~~~~~~~~~~~~
      |                                                                           |                               |
      |                                                                           long int                        unsigned int
      |                                                                         %d
nmgetlib.c: In function ‘agetlib’:
nmgetlib.c:636:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  636 |         fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:638:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  638 |         fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:681:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  681 |     fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:696:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  696 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘aranlib’:
nmgetlib.c:716:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  716 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘qgetlib’:
nmgetlib.c:778:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  778 |         fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:780:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  780 |         fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:811:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  811 |     fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘qranlib’:
nmgetlib.c:834:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  834 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘lgetlib’:
nmgetlib.c:887:7: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  887 |       fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |       ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:925:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  925 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘lget_ann’:
nmgetlib.c:949:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  949 |   fgets(desc,sizeof(desc),lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:951:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  951 |     fgets(desc,sizeof(desc),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:955:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  955 |   fgets(acc,sizeof(acc),lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:957:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  957 |     fgets(acc,sizeof(acc),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:965:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  965 |   fgets(ver,sizeof(ver),lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:967:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  967 |     fgets(ver,sizeof(ver),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘lranlib’:
nmgetlib.c:1041:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1041 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1048:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1048 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘pgetlib’:
nmgetlib.c:1086:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1086 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf); /* get the extra line */
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1108:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1108 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘pranlib’:
nmgetlib.c:1132:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1132 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1135:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1135 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1137:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1137 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1143:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1143 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘egetlib’:
nmgetlib.c:1227:1: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1227 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘eranlib’:
nmgetlib.c:1257:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1257 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1262:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1262 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1265:56: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1265 |   while (lm_fd->lline[0]!='D' || lm_fd->lline[1]!='E') fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |                                                        ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1272:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1272 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘igetlib’:
nmgetlib.c:1305:19: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1305 |                   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |                   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1336:13: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1336 |             fgets(lm_fd->lline,MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
      |             ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1340:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1340 |         fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘iranlib’:
nmgetlib.c:1367:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1367 |         fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1378:11: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1378 |           fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |           ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1387:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1387 |         fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘vgetlib’:
nmgetlib.c:1425:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1425 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1464:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1464 |     fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1470:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1470 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘vranlib’:
nmgetlib.c:1497:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1497 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1511:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1511 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1528:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1528 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘gcg_getlib’:
nmgetlib.c:1570:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1570 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c ncbl2_mlib.c -o ncbl2_mlib.o
nmgetlib.c:1573:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1573 |         fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1575:7: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1575 |       fgets(&lm_fd->lline[strlen(lm_fd->lline)-MAX_STR/2],MAX_STR/2,lm_fd->libf);
      |       ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1595:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1595 |   fread((char *)seqp,(size_t)r_block,(size_t)1,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1610:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1610 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function ‘gcg_ranlib’:
nmgetlib.c:1634:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1634 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1643:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1643 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1674:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1674 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c lib_sel.c
ncbl2_mlib.c: In function ‘ncbl2_getlibn’:
ncbl2_mlib.c:1434:80: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 7 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
 1434 |                 "*** ERROR [%s:%d] - could not read sequence record: %s %lld %ld != %ld: %d\n",
      |                                                                              ~~^
      |                                                                                |
      |                                                                                long int
      |                                                                              %d
 1435 |                 __FILE__,__LINE__,libstr, *libpos,tmp,seqcnt,*seq);
      |                                                   ~~~                           
      |                                                   |
      |                                                   size_t {aka unsigned int}
ncbl2_mlib.c:1454:84: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
 1454 |         fprintf(stderr,"*** ERROR [%s:%d] - could not read sequence record: %lld %ld/%ld\n",
      |                                                                                  ~~^
      |                                                                                    |
      |                                                                                    long int
      |                                                                                  %d
 1455 |                 __FILE__,__LINE__, *libpos,tmp,seqcnt);
      |                                            ~~~                                      
      |                                            |
      |                                            size_t {aka unsigned int}
ncbl2_mlib.c:1594:72: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 1594 |       fprintf(stderr, "*** ERROR [%s:%d] malloc amb table error size %ld\n",
      |                                                                      ~~^
      |                                                                        |
      |                                                                        long int
      |                                                                      %d
 1595 |               __FILE__, __LINE__, amb_cnt * sizeof(unsigned int));
      |                                   ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~        
      |                                           |
      |                                           unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c url_subs.c
ncbl2_mlib.c: In function ‘load_ncbl2’:
ncbl2_mlib.c:810:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  810 |     fread(title_str,(size_t)1,(size_t)title_len,ifile);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:820:7: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  820 |       fread(pdb_title_str,(size_t)1,(size_t)pdb_title_len,ifile);
      |       ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:831:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  831 |     fread(date_str,(size_t)1,(size_t)date_len,ifile);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘ncbl2_ranlib’:
ncbl2_mlib.c:1720:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1720 |     fread(str,(size_t)1,(size_t)(llen),m_fd->hfile);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:1735:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1735 |     fread(my_buff,(size_t)1,llen,m_fd->hfile);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_int4_read’:
ncbl2_mlib.c:1841:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1841 |   fread((char *)&b[0],(size_t)1,(size_t)4,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_long4_read’:
ncbl2_mlib.c:1856:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1856 |   fread((char *)&b[0],(size_t)1,(size_t)4,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_uint4_read’:
ncbl2_mlib.c:1869:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1869 |   fread((char *)&b[0],(size_t)1,(size_t)4,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_long8_read’:
ncbl2_mlib.c:1884:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1884 |   fread((char *)&b[0],(size_t)1,(size_t)8,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘ncbi_long8_read’:
ncbl2_mlib.c:1904:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1904 |   fread((char *)&b[0],(size_t)1,(size_t)8,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_char_read’:
ncbl2_mlib.c:1911:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1911 |   fread(val,(size_t)1,(size_t)1,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function ‘src_fstr_read’:
ncbl2_mlib.c:1916:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
 1916 |   fread(val,(size_t)slen,(size_t)1,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2  -c -o mrandom.o mrandom.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DSW_SSE2 -DSSEARCH initfa.c -o init_sw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o dropgsw2_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSW_SSE2 -c smith_waterman_sse2.c
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c wm_align.c -o lwm_align.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSSEARCH -c cal_cons2.c -o calcons_sw.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c pssm_asn_subs.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DCOMP_MLIB -c comp_lib9.c -o comp_mlib9.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DCOMP_MLIB -c compacc2e.c -o compacc2_s.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DLALIGN -c mshowalign2.c -o lshowalign.o
mshowalign2.c: In function ‘showalign’:
mshowalign2.c:617:64: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
  617 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                              ~~^
      |                                                                |
      |                                                                long unsigned int
      |                                                              %u
  618 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                         ~~~~~~~~~~~~~                           
      |                         |
      |                         size_t {aka unsigned int}
mshowalign2.c:617:68: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
  617 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                                  ~~^
      |                                                                    |
      |                                                                    long unsigned int
      |                                                                  %u
  618 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                                       ~~~~~~~~~~~~~                 
      |                                       |
      |                                       size_t {aka unsigned int}
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DLALIGN initfa.c -o init_lal.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c last_thresh.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o droplal2_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c lsim4.c
lsim4.c: In function ‘ckalloc’:
lsim4.c:994:47: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
  994 |     fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
      |                                             ~~^            ~~~~~~
      |                                               |            |
      |                                               long int     size_t {aka unsigned int}
      |                                             %d
lsim4.c:994:51: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
  994 |     fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
      |                                                 ~~^               ~~~~
      |                                                   |               |
      |                                                   long int        size_t {aka unsigned int}
      |                                                 %d
lsim4.c:994:55: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
  994 |     fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
      |                                                     ~~^                ~~~~~~
      |                                                       |                |
      |                                                       long int         size_t {aka unsigned int}
      |                                                     %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -DLCAL_CONS -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c cal_cons2.c -o calcons_la.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTS initfa.c -o init_fs.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c scaleswt.c -o scaleswts.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c last_tat.c
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
scaleswt.c: In function ‘process_hist’:
scaleswt.c:184:72: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
  184 |       fprintf(stderr,"*** ERROR [%s:%d] -  cannot allocate rs_snion: %ld\n",__FILE__, __LINE__, sizeof(struct pstat_str));
      |                                                                      ~~^                        ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                        |                        |
      |                                                                        long int                 unsigned int
      |                                                                      %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTS tatstats.c -o tatstats_fs.o
scaleswt.c: In function ‘last_stats’:
scaleswt.c:1230:67: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 1230 |       fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate rs_s: %ld\n",__FILE__, __LINE__,sizeof(struct pstat_str));
      |                                                                 ~~^                       ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                   |                       |
      |                                                                   long int                unsigned int
      |                                                                 %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTS -c dropfs2.c -o drop_fs2.o
dropfs2.c: In function ‘init_work’:
dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
  377 |        fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
      |                                                           ~~^
      |                                                             |
      |                                                             long int
      |                                                           %d
  378 |                 tat_size * sizeof(struct tat_str *));
      |                 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~          
      |                          |
      |                          unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTS -c cal_consf.c -o calcons_fs.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTX initfa.c -o init_fx.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c faatran.c
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c dropfx2.c -o drop_fx.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTX -DTFAST initfa.c -o init_tfx.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DTFAST dropfx2.c -o drop_tfx.o
dropfx2.c: In function ‘do_walign’:
dropfx2.c:2660:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2660 |     fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 2661 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
dropfx2.c: In function ‘do_walign’:
dropfx2.c:2660:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2660 |     fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 2661 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTY initfa.c -o init_fy.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c dropfz3.c -o drop_fz.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTY -DTFAST initfa.c -o init_tfy.o
dropfz3.c: In function ‘init_work’:
dropfz3.c:629:79: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
  629 |       fprintf (stderr,"*** ERROR [%s:%d] - cannot allocate diagonal arrays: %lu\n",
      |                                                                             ~~^
      |                                                                               |
      |                                                                               long unsigned int
      |                                                                             %u
dropfz3.c: In function ‘do_walign’:
dropfz3.c:2672:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2672 |     fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 2673 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DTFAST dropfz3.c -o drop_tfz.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
dropfz3.c: In function ‘init_work’:
dropfz3.c:629:79: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
  629 |       fprintf (stderr,"*** ERROR [%s:%d] - cannot allocate diagonal arrays: %lu\n",
      |                                                                             ~~^
      |                                                                               |
      |                                                                               long unsigned int
      |                                                                             %u
dropfz3.c: In function ‘do_walign’:
dropfz3.c:2672:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2672 |     fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 2673 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTS -DTFAST  initfa.c -o init_tfs.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DTFAST -DFASTS dropfs2.c -o drop_tfs.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DTFAST -DFASTS -c cal_consf.c -o calcons_tfs.o
dropfs2.c: In function ‘init_work’:
dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
  377 |        fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
      |                                                           ~~^
      |                                                             |
      |                                                             long int
      |                                                           %d
  378 |                 tat_size * sizeof(struct tat_str *));
      |                 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~          
      |                          |
      |                          unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTM initfa.c -o init_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTM tatstats.c -o tatstats_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTM dropfs2.c -o drop_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTM -c cal_consf.c -o calcons_fm.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
dropfs2.c: In function ‘init_work’:
dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
  377 |        fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
      |                                                           ~~^
      |                                                             |
      |                                                             long int
      |                                                           %d
  378 |                 tat_size * sizeof(struct tat_str *));
      |                 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~          
      |                          |
      |                          unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c mshowalign2.c -o mshowalign2_s.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTM -DTFAST  initfa.c -o init_tfm.o
mshowalign2.c: In function ‘showalign’:
mshowalign2.c:617:64: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
  617 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                              ~~^
      |                                                                |
      |                                                                long unsigned int
      |                                                              %u
  618 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                         ~~~~~~~~~~~~~                           
      |                         |
      |                         size_t {aka unsigned int}
mshowalign2.c:617:68: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=]
  617 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                                  ~~^
      |                                                                    |
      |                                                                    long unsigned int
      |                                                                  %u
  618 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                                       ~~~~~~~~~~~~~                 
      |                                       |
      |                                       size_t {aka unsigned int}
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DTFAST -DFASTM dropfs2.c -o drop_tfm.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DTFAST -DFASTM -c cal_consf.c -o calcons_tfm.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTF initfa.c -o init_ff.o
dropfs2.c: In function ‘init_work’:
dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
  377 |        fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
      |                                                           ~~^
      |                                                             |
      |                                                             long int
      |                                                           %d
  378 |                 tat_size * sizeof(struct tat_str *));
      |                 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~          
      |                          |
      |                          unsigned int
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTF -c scaleswt.c -o scaleswtf.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTF tatstats.c -o tatstats_ff.o
scaleswt.c: In function ‘process_hist’:
scaleswt.c:184:72: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
  184 |       fprintf(stderr,"*** ERROR [%s:%d] -  cannot allocate rs_snion: %ld\n",__FILE__, __LINE__, sizeof(struct pstat_str));
      |                                                                      ~~^                        ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                        |                        |
      |                                                                        long int                 unsigned int
      |                                                                      %d
scaleswt.c: In function ‘last_stats’:
scaleswt.c:1230:67: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 1230 |       fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate rs_s: %ld\n",__FILE__, __LINE__,sizeof(struct pstat_str));
      |                                                                 ~~^                       ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                   |                       |
      |                                                                   long int                unsigned int
      |                                                                 %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTF  dropff2.c -o drop_ff2.o
dropff2.c: In function ‘init_work’:
dropff2.c:120:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
  120 |      fprintf(stderr, "*** ERROR [%s:%d] - cannot calloc f_str [%lu]\n",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
  121 |              __FILE__, __LINE__, sizeof(struct f_struct));
      |                                  ~~~~~~~~~~~~~~~~~~~~~~~          
      |                                  |
      |                                  unsigned int
dropff2.c: In function ‘do_walign’:
dropff2.c:1176:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 1176 |     fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 1177 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTF -c cal_consf.c -o calcons_ff.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTF -DTFAST initfa.c -o init_tf.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTF -DTFAST dropff2.c -o drop_tff.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DTFAST -DFASTF -c cal_consf.c -o calcons_tff.o
dropff2.c: In function ‘init_work’:
dropff2.c:120:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
  120 |      fprintf(stderr, "*** ERROR [%s:%d] - cannot calloc f_str [%lu]\n",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
  121 |              __FILE__, __LINE__, sizeof(struct f_struct));
      |                                  ~~~~~~~~~~~~~~~~~~~~~~~          
      |                                  |
      |                                  unsigned int
dropff2.c: In function ‘do_walign’:
dropff2.c:1176:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 1176 |     fprintf(stderr,"*** ERROR [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 1177 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -DNORMAL_DIST -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c scaleswn.c -o scale_sn.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
scaleswn.c: In function ‘process_hist’:
scaleswn.c:255:55: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=]
  255 |       fprintf(stderr," cannot allocate pstat_union: %ld\n",sizeof(struct pstat_str));
      |                                                     ~~^    ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                       |    |
      |                                                       |    unsigned int
      |                                                       long int
      |                                                     %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DSW_SSE2 -DGLSEARCH initfa.c -o init_lnw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -DSW_SSE2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c dropnnw2.c -o droplnw_sse.o
initfa.c: In function ‘alloc_pam2p’:
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSW_SSE2 -c glocal_sse2.c
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DGGSEARCH -c wm_align.c -o gwm_align.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DSW_SSE2 -DGGSEARCH initfa.c -o init_gnw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -DGLOBAL_GLOBAL -DSW_SSE2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c dropnnw2.c -o dropgnw_sse.o
initfa.c: In function ‘alloc_pam2p’:
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSW_SSE2 -c global_sse2.c
initfa.c:2001:68: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=]
 2001 |               "*** Warning [%s:%d] - Cannot reallocate pam2p[0]: %ld\n", __FILE__, __LINE__, (nsq+1)*len*sizeof(int));
      |                                                                  ~~^                         ~~~~~~~~~~~~~~~~~~~~~~~
      |                                                                    |                                    |
      |                                                                    long int                             unsigned int
      |                                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_TIME_BITS=64 -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64  -o ../bin/map_db map_db.c
map_db.c: In function ‘main’:
map_db.c:149:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  149 |     fgets(lname,sizeof(lname),stdin);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
map_db.c: In function ‘gbf_get_ent’:
map_db.c:512:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  512 |   fgets(lline,MAXLINE,libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~
map_db.c: In function ‘src_int4_read’:
map_db.c:524:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result]
  524 |   fread((char *)&b[0],(size_t)1,(size_t)4,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc  -o ../bin/fasta36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fa.o drop_nfa.o wm_align.o calcons_fa.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm   -lpthread
cc  -o ../bin/ssearch36 comp_mthr9.o	 work_thr2.o  pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_sw_sse.o dropgsw2_sse.o smith_waterman_sse2.o lwm_align.o calcons_sw.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
cc  -o ../bin/lalign36 comp_mlib9.o	 compacc2_s.o showbest.o build_ares.o re_getlib.o lshowalign.o htime.o apam.o doinit.o init_lal.o droplal2_sse.o smith_waterman_sse2.o lsim4.o calcons_la.o scale_se.o karlin.o last_thresh.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm  
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc  -o ../bin/fasts36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fs.o drop_fs2.o calcons_fs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
initfa.c: In function ‘get_lambda.constprop’:
initfa.c:2225:54: warning: argument 1 value ‘3294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2225 |   if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
      |                                                      ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
initfa.c: In function ‘get_lambda.constprop’:
initfa.c:2225:54: warning: argument 1 value ‘3294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2225 |   if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
      |                                                      ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
cc  -o ../bin/fastx36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fx.o drop_fx.o faatran.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc  -o ../bin/tfastx36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfx.o drop_tfx.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc  -o ../bin/fasty36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fy.o drop_fz.o faatran.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc  -o ../bin/tfasty36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfy.o drop_tfz.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 5 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
cc  -o ../bin/tfasts36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfs.o drop_tfs.o calcons_tfs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc  -o ../bin/fastm36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fm.o drop_fm.o calcons_fm.o scaleswts.o last_tat.o tatstats_fm.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc  -o ../bin/tfastm36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_s.o htime.o apam.o doinit.o init_tfm.o drop_tfm.o calcons_tfm.o scaleswts.o tatstats_fm.o last_tat.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowalign2.c:85:1: warning: type of ‘buf_align_seq’ does not match original declaration [-Wlto-type-mismatch]
   85 | buf_align_seq(unsigned char **aa0, int n0,
      | ^
compacc2e.c:3597:1: note: type mismatch in parameter 8
 3597 | buf_align_seq(unsigned char **aa0, int n0,
      | ^
compacc2e.c:3597:1: note: ‘buf_align_seq’ was previously declared here
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc  -o ../bin/fastf36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_ff.o drop_ff2.o calcons_ff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
cc  -o ../bin/tfastf36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tf.o drop_tff.o calcons_tff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: ‘process_hist’ was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 4 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc  -o ../bin/glsearch36 comp_mthr9.o	 work_thr2.o  pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_lnw_sse.o droplnw_sse.o glocal_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
cc  -o ../bin/ggsearch36 comp_mthr9.o	 work_thr2.o  pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_gnw_sse.o dropgnw_sse.o global_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm   -lpthread
compacc2e.c:959:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch]
  959 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:514:3: note: type mismatch in parameter 2
  514 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:514:3: note: ‘re_openlib’ was previously declared here
nmgetlib.c:514:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
mshowbest.c:62:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch]
   62 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2313:1: note: type mismatch in parameter 2
 2313 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2313:1: note: ‘s_annot_to_aa1a’ was previously declared here
compacc2e.c:2313:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: ‘last_calc’ was previously declared here
mshowbest.c:84:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch]
   84 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: type mismatch in parameter 5
 2202 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2202:1: note: ‘get_annot’ was previously declared here
compacc2e.c:2202:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: ‘showalign’ was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used
lto-wrapper: warning: using serial compilation of 6 LTRANS jobs
lto-wrapper: note: see the ‘-flto’ option documentation for more information
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
initfa.c: In function ‘get_lambda.constprop’:
initfa.c:2225:54: warning: argument 1 value ‘3294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2225 |   if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
      |                                                      ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
initfa.c: In function ‘get_lambda.constprop’:
initfa.c:2225:54: warning: argument 1 value ‘3294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2225 |   if (max > 1023 || min < -1024 || ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL)) {
      |                                                      ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
compacc2e.c: In function ‘next_annot_entry.constprop’:
compacc2e.c:2124:55: warning: argument 1 range [2147483649, 4294967295] exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2124 |     if ((s_tmp_ann_entry_arr = (struct annot_entry **)calloc((n_annot+1),sizeof(struct annot_entry *)))==NULL) {
      |                                                       ^
/usr/include/stdlib.h:675:14: note: in a call to allocation function ‘calloc’ declared here
  675 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
make[2]: Leaving directory '/<<PKGBUILDDIR>>/src'
# convoluted, but necessary to allow cross builds
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   debian/rules override_dh_auto_test
make[1]: Entering directory '/<<PKGBUILDDIR>>'
cd test ; ./test2G.sh && ./test.sh && ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg

STARTING FASTA36 Tue May 21 04:16:46 UTC 2024 on test2023
Linux test2023 6.1.47-v8+ #1 SMP PREEMPT Fri Sep 1 07:05:33 BST 2023 aarch64 GNU/Linux

starting prss36(ssearch/fastx) Tue May 21 04:16:46 UTC 2024
done
starting lalign36 Tue May 21 04:16:46 UTC 2024
FINISHED Tue May 21 04:18:41 UTC 2024

STARTING FASTA36 Tue May 21 04:18:41 UTC 2024 on test2023
Linux test2023 6.1.47-v8+ #1 SMP PREEMPT Fri Sep 1 07:05:33 BST 2023 aarch64 GNU/Linux

starting prss36(ssearch/fastx) Tue May 21 04:18:41 UTC 2024
done
starting lalign36 Tue May 21 04:18:42 UTC 2024
FINISHED Tue May 21 04:20:36 UTC 2024
# ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg
FASTA searches a protein or DNA sequence data bank
 version 36.3.8i Nov, 2022
Please cite:
 W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: ../seq/mgstm1.aa
  1>>>sp|P10649|GSTM1_MOUSE Glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; Glutathione S-transferase GT8.7; pmGT10 - 218 aa
Library: ../seq/prot_test.lseg
     2267 residues in    12 sequences

Statistics: (shuffled [476]) MLE statistics: Lambda= 0.1528;  K=0.003669
 statistics sampled from 4 (4) to 475 sequences
Algorithm: FASTA (3.8 Nov 2011) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.667), E-opt: 0.2 (0.333), width:  16
 Scan time:  0.000

The best scores are:                                      opt bits E(12)
sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu ( 218) 1242 283.6 2.4e-80
sp|P00502|GSTA1_RAT Glutathione S-transferase alph ( 222)  237 62.1 1.2e-13
sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Ho ( 142)   51 21.1    0.17
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinas ( 351)   43 19.3     1.3
sp|P14960|RBS_GUITH Ribulose bisphosphate carboxyl ( 139)   36 17.8     1.5
sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG ( 108)   31 16.7     2.4
sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodyte ( 105)   30 16.5     2.7
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle  ( 160)   30 16.5     3.9
sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A (  95)   26 15.6     4.2
sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococc (  54)   22 14.7     4.3
sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A  ( 567)   37 18.0     4.5
sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Ho ( 106)   23 14.9     6.3

>>sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 O  (218 aa)
 initn: 1242 init1: 1242 opt: 1242  Z-score: 1494.3  bits: 283.6 E(12): 2.4e-80
Smith-Waterman score: 1242; 78.0% identity (95.4% similar) in 218 aa overlap (1-218:1-218)

               10        20        30        40        50        60
sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL
       ::::::::..:::.: ::.:::::::::.::.::::::::.:::::::::::::::::::
sp|P09 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
               10        20        30        40        50        60

               70        80        90       100       110       120
sp|P10 PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF
       ::::::.:::::::::: :.::::.: ::::::.::.::.:::.::..::: :.::::.:
sp|P09 PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
               70        80        90       100       110       120

              130       140       150       160       170       180
sp|P10 EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN
       :: ::..:. .:::.:::::::::::::::.:.:.::::.::.:: .:.:::::::::::
sp|P09 EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
              130       140       150       160       170       180

              190       200       210        
sp|P10 LRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
       :.::..:::::.::::::::::..  :.::::: :.::
sp|P09 LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
              190       200       210        

>>sp|P00502|GSTA1_RAT Glutathione S-transferase alpha-1   (222 aa)
 initn: 204 init1:  73 opt: 237  Z-score: 296.9  bits: 62.1 E(12): 1.2e-13
Smith-Waterman score: 237; 27.4% identity (57.0% similar) in 223 aa overlap (4-218:6-218)

                 10        20        30        40        50        
sp|P10   MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKL--GLD
            .: :.:.::  . :: ::  .   .:::         : .:    ::.:   .: 
sp|P00 MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEK---------FIQSPEDLEKLKKDGNLM
               10        20        30                 40        50 

         60         70        80        90       100        110    
sp|P10 FPNLPYL-IDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMD-TRMQLIML
       : ..:.. :::  :..:. ::: :.: :. : :.  .::   :.  . ..: :.: . ..
sp|P00 FDQVPMVEIDG-MKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLV
              60         70        80        90       100       110

          120         130       140         150       160       170
sp|P10 CYNPDFEKQKPEFLK--TIPEKMKLYSEFLGK--RPWFAGDKVTYVDFLAYDILDQYRMF
          :: .. :  . :  :  . .  . . : .  . ...:...: ::.   ..:   . :
sp|P00 ICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEF
              120       130       140       150       160       170

              180       190       200       210            
sp|P10 EPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK    
       . . : .:: :. : .:. .: ... ... .     :. .:. . . :    
sp|P00 DASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
              180       190       200       210       220  

>>sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo s  (142 aa)
 initn:  40 init1:  40 opt:  51  Z-score: 78.8  bits: 21.1 E(12): 0.17
Smith-Waterman score: 51; 25.6% identity (69.2% similar) in 39 aa overlap (177-214:36-73)

        150       160       170       180       190       200      
sp|P10 WFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS-SRYIA
                                     .::. . .. .:. :.. :: .:. .. .:
sp|P69 ADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFD-LSHGSAQVKGHGKKVA
          10        20        30        40         50        60    

         210                                                       
sp|P10 TPIFSKMAHWSNK                                               
         . . .::                                                   
sp|P69 DALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHA
           70        80        90       100       110       120    

>>sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase ca  (351 aa)
 initn:  43 init1:  43 opt:  43  Z-score: 62.2  bits: 19.3 E(12):  1.3
Smith-Waterman score: 54; 23.6% identity (47.2% similar) in 72 aa overlap (137-206:229-300)

        110       120       130       140       150       160      
sp|P10 TRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQ
                                     .:    :  :.:: . .   . ..   .  
sp|P00 LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRF
      200       210       220       230       240       250        

        170       180         190       200       210              
sp|P10 YRMFEPKCLDAFPNLR--DFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK      
          :     : . ::   :.  :: .::.    .:. ...::                  
sp|P00 PSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPK
      260       270       280       290       300       310        

sp|P00 FKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
      320       330       340       350 

>>sp|P14960|RBS_GUITH Ribulose bisphosphate carboxylase   (139 aa)
 initn:  56 init1:  36 opt:  36  Z-score: 61.1  bits: 17.8 E(12):  1.5
Smith-Waterman score: 36; 57.1% identity (85.7% similar) in 7 aa overlap (7-13:47-53)

                                       10        20        30      
sp|P10                         MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMG
                                     ::.. ::                       
sp|P14 EQIVKQIQYAISKNWALNVEWTDDPHPRNAYWDLWGLPLFGIKDPAAVMFEINACRKAKP
         20        30        40        50        60        70      

         40        50        60        70        80        90      
sp|P10 DAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIR
                                                                   
sp|P14 ACYVKVNAFDNSRGVESCCLSFIVQRPTSNEPGFQLIRSEVDSRNIRYTIQSYASTRPEG
         80        90       100       110       120       130      

>>sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=  (108 aa)
 initn:  31 init1:  31 opt:  31  Z-score: 57.1  bits: 16.7 E(12):  2.4
Smith-Waterman score: 33; 36.0% identity (54.0% similar) in 50 aa overlap (150-190:16-64)

     120       130       140       150       160          170      
sp|P10 FEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDI---LDQYRMFE---PK
                                     ::.:: .   . ::   :. :..     ::
sp|P01                DIQMTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPK
                              10        20        30        40     

             180        190       200       210                    
sp|P10 CL--DAFPNLRDFL-ARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK            
        :  ::  ::.  . .:: :                                        
sp|P01 ILIYDA-SNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKL
          50         60        70        80        90       100    

>>sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodytes GN  (105 aa)
 initn:  30 init1:  30 opt:  30  Z-score: 56.1  bits: 16.5 E(12):  2.7
Smith-Waterman score: 36; 26.5% identity (54.4% similar) in 68 aa overlap (129-193:28-88)

      100       110       120       130       140          150     
sp|P10 IVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWF---AGDKVTY
                                     :: :.   :...  :. : .   :..:   
sp|P99    MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKG
                  10        20        30        40        50       

         160       170       180       190       200       210     
sp|P10 VDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHW
       . . . : : .: . .::    .:. . .   : :.::                      
sp|P99 I-IWGEDTLMEY-LENPK--KYIPGTKMI---FVGIKKKEERADLIAYLKKATNE     
         60         70          80           90       100          

          
sp|P10 SNK

>>sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=H  (160 aa)
 initn:  30 init1:  30 opt:  30  Z-score: 52.9  bits: 16.5 E(12):  3.9
Smith-Waterman score: 41; 25.9% identity (63.0% similar) in 54 aa overlap (44-92:13-62)

            20        30        40        50        60        70   
sp|P10 THPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--
                                     :. .  .:: ..:.    .  ::.  :.  
sp|P02                   MTDQQAEARSYLSEEMIAEFKAAFDM----FDADGGGDISVK
                                 10        20            30        

              80           90       100       110       120        
sp|P10 QSNAILRYLAR---KHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFL
       . ....:.:..   :..::.  ::                                    
sp|P02 ELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAE
       40        50        60        70        80        90        

>>sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A31 O  (95 aa)
 initn:  26 init1:  26 opt:  26  Z-score: 52.2  bits: 15.6 E(12):  4.2
Smith-Waterman score: 30; 54.5% identity (63.6% similar) in 11 aa overlap (115-125:86-94)

           90       100       110       120       130       140    
sp|P10 HLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGK
                                     : ::   ::.:                   
sp|P60 SRGKVVELGCAATCPSKKPYEEVTCCSTDKC-NPH-PKQRPG                  
          60        70        80          90                       

          150       160       170       180       190       200    
sp|P10 RPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYI

>>sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococcus a  (54 aa)
 initn:  22 init1:  22 opt:  22  Z-score: 51.8  bits: 14.7 E(12):  4.3
Smith-Waterman score: 25; 50.0% identity (100.0% similar) in 4 aa overlap (171-174:15-18)

              150       160       170       180       190       200
sp|P10 FLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS
                                     .:.:                          
sp|P00                 AYVINDSCIACGACKPECPVNIQQGSIYAIDADSCIDCGSCASV
                               10        20        30        40    

              210        
sp|P10 SRYIATPIFSKMAHWSNK
                         
sp|P00 CPVGAPNPED        
           50            

>>sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A viru  (567 aa)
 initn:  37 init1:  37 opt:  37  Z-score: 51.3  bits: 18.0 E(12):  4.5
Smith-Waterman score: 50; 28.2% identity (64.1% similar) in 39 aa overlap (74-111:399-437)

            50        60        70        80         90       100  
sp|P10 SQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARK-HHLDGETEEERIRADIVEN
                                     : ...   .: :... :  : . : . .:.
sp|P03 GFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEK
      370       380       390       400       410       420        

            110       120       130       140       150       160  
sp|P10 QVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYD
        : ::...:                                                   
sp|P03 YVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYH
      430       440       450       460       470       480        

>>sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Homo s  (106 aa)
 initn:  23 init1:  23 opt:  23  Z-score: 47.7  bits: 14.9 E(12):  6.3
Smith-Waterman score: 35; 18.3% identity (53.5% similar) in 71 aa overlap (58-124:12-82)

        30        40        50        60        70          80     
sp|P10 YDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--QSNAILRYLARKHH
                                     :.   : .:. ...   .:   :    . .
sp|P01                    TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK
                                  10        20        30        40 

          90       100       110         120       130       140   
sp|P10 LDGETEEERIRADIVENQVMDTRMQL--IMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLG
       .:.  .    . ...:..  :. ..:   .   . :.::.:                   
sp|P01 VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
              50        60        70        80        90       100 

           150       160       170       180       190       200   
sp|P10 KRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRY
                                                                   
sp|P01 NRGEC                                                       
                                                                   



218 residues in 1 query   sequences
2267 residues in 12 library sequences
 Tcomplib [36.3.8i Nov, 2022] (4 proc in memory [0G])
 start: Tue May 21 04:20:36 2024 done: Tue May 21 04:20:36 2024
 Total Scan time:  0.000 Total Display time:  0.020

Function used was FASTA [36.3.8i Nov, 2022]
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   create-stamp debian/debhelper-build-stamp
   dh_testroot -a -O--sourcedirectory=src
   dh_prep -a -O--sourcedirectory=src
   dh_auto_install -a -O--sourcedirectory=src
   dh_install -a -O--sourcedirectory=src
   dh_installdocs -a -O--sourcedirectory=src
   dh_installchangelogs -a -O--sourcedirectory=src
   dh_installexamples -a -O--sourcedirectory=src
   dh_installman -a -O--sourcedirectory=src
   dh_installsystemduser -a -O--sourcedirectory=src
   dh_perl -a -O--sourcedirectory=src
   dh_link -a -O--sourcedirectory=src
   dh_strip_nondeterminism -a -O--sourcedirectory=src
   debian/rules override_dh_compress
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_compress --exclude=.pdf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   dh_fixperms -a -O--sourcedirectory=src
   dh_missing -a -O--sourcedirectory=src
   dh_dwz -a -O--sourcedirectory=src
   dh_strip -a -O--sourcedirectory=src
   dh_makeshlibs -a -O--sourcedirectory=src
   dh_shlibdeps -a -O--sourcedirectory=src
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/fasta3/usr/bin/tfastf36 debian/fasta3/usr/bin/fasts36 debian/fasta3/usr/bin/ggsearch36 debian/fasta3/usr/bin/fastf36 debian/fasta3/usr/bin/tfasts36 debian/fasta3/usr/bin/tfastx36 debian/fasta3/usr/bin/map_db debian/fasta3/usr/bin/lalign36 debian/fasta3/usr/bin/fastx36 debian/fasta3/usr/bin/tfasty36 debian/fasta3/usr/bin/fastm36 debian/fasta3/usr/bin/fasty36 debian/fasta3/usr/bin/glsearch36 debian/fasta3/usr/bin/ssearch36 debian/fasta3/usr/bin/fasta36 debian/fasta3/usr/bin/tfastm36 were not linked against ld-linux-armhf.so.3 (they use none of the library's symbols)
   dh_installdeb -a -O--sourcedirectory=src
   dh_gencontrol -a -O--sourcedirectory=src
   dh_md5sums -a -O--sourcedirectory=src
   dh_builddeb -a -O--sourcedirectory=src
dpkg-deb: building package 'fasta3-dbgsym' in '../fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b6_armhf.deb'.
dpkg-deb: building package 'fasta3' in '../fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.deb'.
 dpkg-genbuildinfo --build=any -O../fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.buildinfo
 dpkg-genchanges --build=any -mRaspbian pi5 test autobuilder <root@raspbian.org> -O../fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.changes
dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included)
 dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
--------------------------------------------------------------------------------
Build finished at 2024-05-21T04:20:46Z

Finished
--------

I: Built successfully

+------------------------------------------------------------------------------+
| Changes                                                                      |
+------------------------------------------------------------------------------+


fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.changes:
----------------------------------------------

Format: 1.8
Date: Tue, 21 May 2024 04:15:15 +0000
Source: fasta3 (36.3.8i.14-Nov-2020-1)
Binary: fasta3 fasta3-dbgsym
Binary-Only: yes
Architecture: armhf
Version: 36.3.8i.14-Nov-2020-1+b6
Distribution: trixie-staging
Urgency: low
Maintainer: Raspbian pi5 test autobuilder <root@raspbian.org>
Changed-By: Raspbian pi5 test autobuilder <root@raspbian.org>
Description:
 fasta3     - tools for searching collections of biological sequences
Changes:
 fasta3 (36.3.8i.14-Nov-2020-1+b6) trixie-staging; urgency=low, binary-only=yes
 .
   * Binary-only non-maintainer upload for armhf; no source changes.
   * rebuild due to debcheck failure
Checksums-Sha1:
 53198623f8d641f946aca96dec07aa57c9396afa 5412584 fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b6_armhf.deb
 0f2edb11fca177d31c02bf925c2829ef8d58199d 5763 fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.buildinfo
 da8f851523e91100c1dbb32d36b2238244cef0ff 761672 fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.deb
Checksums-Sha256:
 3e5ab7b1b6c5a0a4923cbca486564a94c9cbb0105dfa9dd846d16c93e306a910 5412584 fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b6_armhf.deb
 f40e4ef15ba6db7d946dcd2f202e9a37ecdfc2419dfc26186d0380aed7b88e9b 5763 fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.buildinfo
 1f544fabfd00ff64e87bca44aa299d03f9a408385845010a0964c883ff61fdee 761672 fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.deb
Files:
 21840117122d634ca167d6ee2684e95d 5412584 debug optional fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b6_armhf.deb
 b2f58bb1b1ed676fb9f7e1b1c6e0fd9d 5763 science optional fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.buildinfo
 ebeea352353222634ff220689364e036 761672 science optional fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.deb

+------------------------------------------------------------------------------+
| Buildinfo                                                                    |
+------------------------------------------------------------------------------+

Format: 1.0
Source: fasta3 (36.3.8i.14-Nov-2020-1)
Binary: fasta3 fasta3-dbgsym
Architecture: armhf
Version: 36.3.8i.14-Nov-2020-1+b6
Binary-Only-Changes:
 fasta3 (36.3.8i.14-Nov-2020-1+b6) trixie-staging; urgency=low, binary-only=yes
 .
   * Binary-only non-maintainer upload for armhf; no source changes.
   * rebuild due to debcheck failure
 .
  -- Raspbian pi5 test autobuilder <root@raspbian.org>  Tue, 21 May 2024 04:15:15 +0000
Checksums-Md5:
 21840117122d634ca167d6ee2684e95d 5412584 fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b6_armhf.deb
 ebeea352353222634ff220689364e036 761672 fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.deb
Checksums-Sha1:
 53198623f8d641f946aca96dec07aa57c9396afa 5412584 fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b6_armhf.deb
 da8f851523e91100c1dbb32d36b2238244cef0ff 761672 fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.deb
Checksums-Sha256:
 3e5ab7b1b6c5a0a4923cbca486564a94c9cbb0105dfa9dd846d16c93e306a910 5412584 fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b6_armhf.deb
 1f544fabfd00ff64e87bca44aa299d03f9a408385845010a0964c883ff61fdee 761672 fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.deb
Build-Origin: Raspbian
Build-Architecture: armhf
Build-Date: Tue, 21 May 2024 04:20:46 +0000
Build-Path: /<<PKGBUILDDIR>>
Build-Tainted-By:
 merged-usr-via-aliased-dirs
Installed-Build-Depends:
 autoconf (= 2.71-3),
 automake (= 1:1.16.5-1.3),
 autopoint (= 0.21-14),
 autotools-dev (= 20220109.1),
 base-files (= 13+rpi1),
 base-passwd (= 3.6.3),
 bash (= 5.2.21-2),
 binutils (= 2.41-6+rpi1+b1),
 binutils-arm-linux-gnueabihf (= 2.41-6+rpi1+b1),
 binutils-common (= 2.41-6+rpi1+b1),
 bsdextrautils (= 2.40.1-1),
 bsdutils (= 1:2.40.1-1),
 build-essential (= 12.10),
 bzip2 (= 1.0.8-5.1),
 coreutils (= 9.4-3.1),
 cpp (= 4:13.2.0-1+rpi1),
 cpp-12 (= 12.3.0-14+rpi1),
 cpp-13 (= 13.2.0-16.1+rpi1),
 cpp-13-arm-linux-gnueabihf (= 13.2.0-16.1+rpi1),
 dash (= 0.5.12-6),
 debconf (= 1.5.86),
 debhelper (= 13.15.3),
 debianutils (= 5.17),
 dh-autoreconf (= 20),
 dh-strip-nondeterminism (= 1.13.1-1),
 diffutils (= 1:3.10-1),
 dpkg (= 1.22.5+rpi1),
 dpkg-dev (= 1.22.5+rpi1),
 dwz (= 0.15-1+b2),
 file (= 1:5.45-3),
 findutils (= 4.9.0-5),
 g++ (= 4:13.2.0-1+rpi1),
 g++-13 (= 13.2.0-16.1+rpi1),
 g++-13-arm-linux-gnueabihf (= 13.2.0-16.1+rpi1),
 gcc (= 4:13.2.0-1+rpi1),
 gcc-12 (= 12.3.0-14+rpi1),
 gcc-12-base (= 12.3.0-14+rpi1),
 gcc-13 (= 13.2.0-16.1+rpi1),
 gcc-13-arm-linux-gnueabihf (= 13.2.0-16.1+rpi1),
 gcc-13-base (= 13.2.0-16.1+rpi1),
 gcc-14-base (= 14-20240221-2.1+rpi1),
 gettext (= 0.21-14),
 gettext-base (= 0.21-14),
 grep (= 3.11-4),
 groff-base (= 1.23.0-3),
 gzip (= 1.12-1.1),
 hostname (= 3.23+nmu2),
 init-system-helpers (= 1.66),
 intltool-debian (= 0.35.0+20060710.6),
 libacl1 (= 2.3.2-2+rpi1),
 libarchive-zip-perl (= 1.68-1),
 libasan8 (= 14-20240221-2.1+rpi1),
 libatomic1 (= 14-20240221-2.1+rpi1),
 libattr1 (= 1:2.5.2-1),
 libaudit-common (= 1:3.1.2-2),
 libaudit1 (= 1:3.1.2-2),
 libbinutils (= 2.41-6+rpi1+b1),
 libblkid1 (= 2.40.1-1),
 libbz2-1.0 (= 1.0.8-5.1),
 libc-bin (= 2.38-8+rpi1),
 libc-dev-bin (= 2.38-8+rpi1),
 libc6 (= 2.38-8+rpi1),
 libc6-dev (= 2.38-8+rpi1),
 libcap-ng0 (= 0.8.5-1),
 libcap2 (= 1:2.66-5),
 libcc1-0 (= 14-20240221-2.1+rpi1),
 libcrypt-dev (= 1:4.4.36-4),
 libcrypt1 (= 1:4.4.36-4),
 libctf-nobfd0 (= 2.41-6+rpi1+b1),
 libctf0 (= 2.41-6+rpi1+b1),
 libdata-optlist-perl (= 0.114-1),
 libdb5.3t64 (= 5.3.28+dfsg2-7),
 libdebconfclient0 (= 0.271),
 libdebhelper-perl (= 13.15.3),
 libdpkg-perl (= 1.22.5+rpi1),
 libelf1t64 (= 0.191-1+rpi1),
 libfile-stripnondeterminism-perl (= 1.13.1-1),
 libgcc-12-dev (= 12.3.0-14+rpi1),
 libgcc-13-dev (= 13.2.0-16.1+rpi1),
 libgcc-s1 (= 14-20240221-2.1+rpi1),
 libgcrypt20 (= 1.10.3-3),
 libgdbm-compat4t64 (= 1.23-5.1+b1),
 libgdbm6t64 (= 1.23-5.1+b1),
 libgmp10 (= 2:6.3.0+dfsg-2),
 libgomp1 (= 14-20240221-2.1+rpi1),
 libgpg-error0 (= 1.49-2),
 libicu72 (= 72.1-4+b1),
 libisl23 (= 0.26-3),
 libjansson4 (= 2.14-2),
 liblz4-1 (= 1.9.4-1+rpi1+b2),
 liblzma5 (= 5.6.1+really5.4.5-1),
 libmagic-mgc (= 1:5.45-3),
 libmagic1t64 (= 1:5.45-3),
 libmd0 (= 1.1.0-2),
 libmount1 (= 2.40.1-1),
 libmpc3 (= 1.3.1-1),
 libmpfr6 (= 4.2.1-1),
 libpam-modules (= 1.5.3-7),
 libpam-modules-bin (= 1.5.3-7),
 libpam-runtime (= 1.5.3-7),
 libpam0g (= 1.5.3-7),
 libparams-util-perl (= 1.102-3),
 libpcre2-8-0 (= 10.42-4+b1),
 libperl5.38t64 (= 5.38.2-4),
 libpipeline1 (= 1.5.7-2),
 libseccomp2 (= 2.5.5-1+rpi1),
 libselinux1 (= 3.5-2+b2),
 libsframe1 (= 2.41-6+rpi1+b1),
 libsimde-dev (= 0.8.2-1),
 libsmartcols1 (= 2.40.1-1),
 libssl3t64 (= 3.2.1-3),
 libstdc++-13-dev (= 13.2.0-16.1+rpi1),
 libstdc++6 (= 14-20240221-2.1+rpi1),
 libsub-exporter-perl (= 0.990-1),
 libsub-install-perl (= 0.929-1),
 libsub-override-perl (= 0.11-1),
 libsub-prototype-perl (= 0.03-2+b2),
 libsystemd0 (= 255.3-1+rpi1+b1),
 libtinfo6 (= 6.5-2),
 libtool (= 2.4.7-7),
 libubsan1 (= 14-20240221-2.1+rpi1),
 libuchardet0 (= 0.0.8-1),
 libudev1 (= 255.3-1+rpi1+b1),
 libunistring5 (= 1.2-1),
 libuuid1 (= 2.40.1-1),
 libxml2 (= 2.9.14+dfsg-1.3+b4),
 libzstd1 (= 1.5.5+dfsg2-2),
 linux-libc-dev (= 6.5.6-1+rpi1+b1),
 login (= 1:4.13+dfsg1-4),
 m4 (= 1.4.19-4),
 make (= 4.3-4.1),
 man-db (= 2.12.1-1),
 mawk (= 1.3.4.20240123-1),
 ncurses-base (= 6.5-2),
 ncurses-bin (= 6.5-2),
 patch (= 2.7.6-7),
 perl (= 5.38.2-4),
 perl-base (= 5.38.2-4),
 perl-modules-5.38 (= 5.38.2-4),
 po-debconf (= 1.0.21+nmu1),
 rpcsvc-proto (= 1.4.3-1),
 sed (= 4.9-2),
 sensible-utils (= 0.0.22),
 sysvinit-utils (= 3.09-1),
 tar (= 1.35+dfsg-3),
 usr-is-merged (= 39),
 util-linux (= 2.40.1-1),
 xz-utils (= 5.6.1+really5.4.5-1),
 zlib1g (= 1:1.3.dfsg+really1.3.1-1)
Environment:
 DEB_BUILD_OPTIONS="parallel=4"
 LANG="en_GB.UTF-8"
 LC_ALL="C.UTF-8"
 LC_COLLATE="C.UTF-8"
 SOURCE_DATE_EPOCH="1716264915"


+------------------------------------------------------------------------------+
| Package contents                                                             |
+------------------------------------------------------------------------------+


fasta3-dbgsym_36.3.8i.14-Nov-2020-1+b6_armhf.deb
------------------------------------------------

 new Debian package, version 2.0.
 size 5412584 bytes: control archive=1352 bytes.
    1040 bytes,    12 lines      control
    1782 bytes,    17 lines      md5sums
 Package: fasta3-dbgsym
 Source: fasta3 (36.3.8i.14-Nov-2020-1)
 Version: 36.3.8i.14-Nov-2020-1+b6
 Auto-Built-Package: debug-symbols
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 5942
 Depends: fasta3 (= 36.3.8i.14-Nov-2020-1+b6)
 Section: debug
 Priority: optional
 Description: debug symbols for fasta3
 Build-Ids: 0615342989e0cb94a328e9862ed2b05a6a5b0c0a 09e606480f483666cc8f269c26c678d05e81cf2d 1edc79071740d975558dc8e41e3af1301663dee4 220f60632bfcdc1acdde3cd1afd02fdd8c617b72 393c8e4beb0e0eb87cce8b4db6249a7f15b6f5c2 42d201bd1df771dd20f3b7454c3104dc56419b6e 44b5d206f27bc503a14405d96881675e7e2be4fd 6caab00b5c40bdb20db4567280ce8118ca15e05d 70ac8b54a0d6fe931b469f8b20ca3a8a4510ce3f 72d573f9cd7860635119fa9841234df6a232ba9c 7499e7d67da662c9f3a1d3184b83764308cfeb59 970a016e454062a5279bcc51a6b8d657cbee4b74 d3f7caf8bb58273b074bfa48af1215dbefa5fb2b da707383fbe9fd28414e45741758db3720d50723 e2519bb7a662ac28d0b4b2906b2eba7f928a2fc0 ed8a6106eca4dadd8fcd59010ff709c41af5e2e4

drwxr-xr-x root/root         0 2024-05-21 04:15 ./
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/06/
-rw-r--r-- root/root    436496 2024-05-21 04:15 ./usr/lib/debug/.build-id/06/15342989e0cb94a328e9862ed2b05a6a5b0c0a.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/09/
-rw-r--r-- root/root    408100 2024-05-21 04:15 ./usr/lib/debug/.build-id/09/e606480f483666cc8f269c26c678d05e81cf2d.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/1e/
-rw-r--r-- root/root    354324 2024-05-21 04:15 ./usr/lib/debug/.build-id/1e/dc79071740d975558dc8e41e3af1301663dee4.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/22/
-rw-r--r-- root/root    452308 2024-05-21 04:15 ./usr/lib/debug/.build-id/22/0f60632bfcdc1acdde3cd1afd02fdd8c617b72.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/39/
-rw-r--r-- root/root    354512 2024-05-21 04:15 ./usr/lib/debug/.build-id/39/3c8e4beb0e0eb87cce8b4db6249a7f15b6f5c2.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/42/
-rw-r--r-- root/root    358728 2024-05-21 04:15 ./usr/lib/debug/.build-id/42/d201bd1df771dd20f3b7454c3104dc56419b6e.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/44/
-rw-r--r-- root/root    355008 2024-05-21 04:15 ./usr/lib/debug/.build-id/44/b5d206f27bc503a14405d96881675e7e2be4fd.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/6c/
-rw-r--r-- root/root     15928 2024-05-21 04:15 ./usr/lib/debug/.build-id/6c/aab00b5c40bdb20db4567280ce8118ca15e05d.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/70/
-rw-r--r-- root/root    405408 2024-05-21 04:15 ./usr/lib/debug/.build-id/70/ac8b54a0d6fe931b469f8b20ca3a8a4510ce3f.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/72/
-rw-r--r-- root/root    411812 2024-05-21 04:15 ./usr/lib/debug/.build-id/72/d573f9cd7860635119fa9841234df6a232ba9c.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/74/
-rw-r--r-- root/root    438880 2024-05-21 04:15 ./usr/lib/debug/.build-id/74/99e7d67da662c9f3a1d3184b83764308cfeb59.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/97/
-rw-r--r-- root/root    449728 2024-05-21 04:15 ./usr/lib/debug/.build-id/97/0a016e454062a5279bcc51a6b8d657cbee4b74.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/d3/
-rw-r--r-- root/root    358900 2024-05-21 04:15 ./usr/lib/debug/.build-id/d3/f7caf8bb58273b074bfa48af1215dbefa5fb2b.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/da/
-rw-r--r-- root/root    413548 2024-05-21 04:15 ./usr/lib/debug/.build-id/da/707383fbe9fd28414e45741758db3720d50723.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/e2/
-rw-r--r-- root/root    403300 2024-05-21 04:15 ./usr/lib/debug/.build-id/e2/519bb7a662ac28d0b4b2906b2eba7f928a2fc0.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.build-id/ed/
-rw-r--r-- root/root    350244 2024-05-21 04:15 ./usr/lib/debug/.build-id/ed/8a6106eca4dadd8fcd59010ff709c41af5e2e4.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.dwz/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/lib/debug/.dwz/arm-linux-gnueabihf/
-rw-r--r-- root/root     79980 2024-05-21 04:15 ./usr/lib/debug/.dwz/arm-linux-gnueabihf/fasta3.debug
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/doc/
lrwxrwxrwx root/root         0 2024-05-21 04:15 ./usr/share/doc/fasta3-dbgsym -> fasta3


fasta3_36.3.8i.14-Nov-2020-1+b6_armhf.deb
-----------------------------------------

 new Debian package, version 2.0.
 size 761672 bytes: control archive=5964 bytes.
    2219 bytes,    55 lines      control
   13996 bytes,   189 lines      md5sums
 Package: fasta3
 Source: fasta3 (36.3.8i.14-Nov-2020-1)
 Version: 36.3.8i.14-Nov-2020-1+b6
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 5891
 Depends: libc6 (>= 2.34), python3
 Recommends: r-base-core
 Suggests: perl:any, libdbi-perl, libwww-perl, libjson-perl, libhtml-tableextract-perl, libxml-twig-perl, liburi-encode-perl, libdbd-mysql-perl, python3-mysqldb, ncbi-blast+, bedtools
 Section: science
 Priority: optional
 Homepage: https://fasta.bioch.virginia.edu
 Description: tools for searching collections of biological sequences
  The FASTA programs find regions of local or global similarity between
  Protein or DNA sequences, either by searching Protein or DNA databases,
  or by identifying local duplications within a sequence. Other
  programs provide information on the statistical significance of an
  alignment. Like BLAST, FASTA can be used to infer functional and
  evolutionary relationships between sequences as well as help identify
  members of gene families.
  .
   * Protein
     - Protein-protein FASTA
     - Protein-protein Smith-Waterman (ssearch)
     - Global Protein-protein (Needleman-Wunsch) (ggsearch)
     - Global/Local protein-protein (glsearch)
     - Protein-protein with unordered peptides (fasts)
     - Protein-protein with mixed peptide sequences (fastf)
  .
   * Nucleotide
     - Nucleotide-Nucleotide (DNA/RNA fasta)
     - Ordered Nucleotides vs Nucleotide (fastm)
     - Un-ordered Nucleotides vs Nucleotide (fasts)
  .
   * Translated
     - Translated DNA (with frameshifts, e.g. ESTs)
       vs Proteins (fastx/fasty)
     - Protein vs Translated DNA (with frameshifts)
       (tfastx/tfasty)
     - Peptides vs Translated DNA (tfasts)
  .
   * Statistical Significance
     - Protein vs Protein shuffle (prss)
     - DNA vs DNA shuffle (prss)
     - Translated DNA vs Protein shuffle (prfx)
  .
   * Local Duplications
     - Local Protein alignments (lalign)
     - Plot Protein alignment "dot-plot" (plalign)
     - Local DNA alignments (lalign)
     - Plot DNA alignment "dot-plot" (plalign)
  .
  This software is often used via a web service at the
  EBI with readily indexed reference databases at
  http://www.ebi.ac.uk/Tools/fasta/.

drwxr-xr-x root/root         0 2024-05-21 04:15 ./
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/bin/
-rwxr-xr-x root/root    334088 2024-05-21 04:15 ./usr/bin/fasta36
-rwxr-xr-x root/root    283412 2024-05-21 04:15 ./usr/bin/fastf36
-rwxr-xr-x root/root    283356 2024-05-21 04:15 ./usr/bin/fastm36
-rwxr-xr-x root/root    283356 2024-05-21 04:15 ./usr/bin/fasts36
-rwxr-xr-x root/root    330064 2024-05-21 04:15 ./usr/bin/fastx36
-rwxr-xr-x root/root    334160 2024-05-21 04:15 ./usr/bin/fasty36
-rwxr-xr-x root/root    378992 2024-05-21 04:15 ./usr/bin/ggsearch36
-rwxr-xr-x root/root    383088 2024-05-21 04:15 ./usr/bin/glsearch36
-rwxr-xr-x root/root    362608 2024-05-21 04:15 ./usr/bin/lalign36
-rwxr-xr-x root/root      9816 2024-05-21 04:15 ./usr/bin/map_db
-rwxr-xr-x root/root    362728 2024-05-21 04:15 ./usr/bin/ssearch36
-rwxr-xr-x root/root    283684 2024-05-21 04:15 ./usr/bin/tfastf36
-rwxr-xr-x root/root    287724 2024-05-21 04:15 ./usr/bin/tfastm36
-rwxr-xr-x root/root    287724 2024-05-21 04:15 ./usr/bin/tfasts36
-rwxr-xr-x root/root    325968 2024-05-21 04:15 ./usr/bin/tfastx36
-rwxr-xr-x root/root    334160 2024-05-21 04:15 ./usr/bin/tfasty36
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/doc/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/doc/fasta3/
-rw-r--r-- root/root       226 2024-05-21 04:15 ./usr/share/doc/fasta3/changelog.Debian.armhf.gz
-rw-r--r-- root/root      1181 2024-05-21 04:15 ./usr/share/doc/fasta3/changelog.Debian.gz
-rw-r--r-- root/root      2874 2022-12-25 18:00 ./usr/share/doc/fasta3/copyright
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/doc/fasta3/examples/
drwxr-xr-x root/root         0 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/
-rw-r--r-- root/root      2528 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/bovgh.seq
-rw-r--r-- root/root       986 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/bovprl.seq
-rw-r--r-- root/root      3159 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/dna_test_s.nlib
-rw-r--r-- root/root       261 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/dyr_human.aa
-rw-r--r-- root/root      1286 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/egmsmg.aa
-rw-r--r-- root/root       806 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/grou_drome.pseg
-rw-r--r-- root/root     18633 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gst.nlib
-rw-r--r-- root/root      1405 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gst.seq
-rw-r--r-- root/root       309 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstm1_human.vaa
-rw-r--r-- root/root      1226 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstm1b_human.nt
-rw-r--r-- root/root      1226 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstm1b_human_fs.nt
-rw-r--r-- root/root       304 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gstt1_drome.aa
-rw-r--r-- root/root       311 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gtm1_human.aa
-rw-r--r-- root/root       291 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/gtt1_drome.aa
-rw-r--r-- root/root       247 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/h10_human.aa
-rw-r--r-- root/root       225 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/hahu.aa
-rw-r--r-- root/root      7118 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.gcg
-rw-r--r-- root/root      2788 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.seq
-rw-r--r-- root/root      1323 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/humgstd.seq
-rw-r--r-- root/root       271 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/lcbo.aa
-rw-r--r-- root/root        56 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/m1r.aa
-rw-r--r-- root/root        50 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/m2.aa
-rw-r--r-- root/root       189 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mchu.aa
-rw-r--r-- root/root      3440 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.3nt
-rw-r--r-- root/root       342 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.aa
-rw-r--r-- root/root       310 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.aaa
-rw-r--r-- root/root      1220 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.e05
-rw-r--r-- root/root      1122 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.eeq
-rw-r--r-- root/root      1116 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.esq
-rw-r--r-- root/root       406 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.gcg
-rw-r--r-- root/root       282 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.lc
-rw-r--r-- root/root       677 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt
-rw-r--r-- root/root       682 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1
-rw-r--r-- root/root      1352 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt12r
-rw-r--r-- root/root      2033 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13
-rw-r--r-- root/root      2028 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13r
-rw-r--r-- root/root       681 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1r
-rw-r--r-- root/root       160 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.nts
-rw-r--r-- root/root       259 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.raa
-rw-r--r-- root/root      1167 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.rev
-rw-r--r-- root/root      1158 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1.seq
-rw-r--r-- root/root    148692 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgstm1_genclone.seq
-rw-r--r-- root/root      1286 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mgtt2_x.seq
-rw-r--r-- root/root        43 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/ms1.aa
-rw-r--r-- root/root      2361 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mu.lib
-rw-r--r-- root/root       275 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/musplfm.aa
-rw-r--r-- root/root      2047 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mwkw.aa
-rw-r--r-- root/root       500 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/mwrtc1.aa
-rw-r--r-- root/root      1294 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/myosin_bp.aa
-rw-r--r-- root/root        27 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n0.aa
-rw-r--r-- root/root        47 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n1.aa
-rw-r--r-- root/root       692 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2.aa
-rw-r--r-- root/root      1482 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2_fs.lib
-rw-r--r-- root/root       178 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2s.aa
-rw-r--r-- root/root       243 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n2t.aa
-rw-r--r-- root/root       330 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/n_fs.lib
-rw-r--r-- root/root       217 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/ngt.aa
-rw-r--r-- root/root       111 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/ngts.aa
-rw-r--r-- root/root       385 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/oohu.aa
-rw-r--r-- root/root       401 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/oohu.raa
-rw-r--r-- root/root       340 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prio_atepa.aa
-rw-r--r-- root/root      2741 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prot_test.lib
-rw-r--r-- root/root      3391 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prot_test.lseg
-rw-r--r-- root/root      1530 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/prot_test_s.lseg
-rw-r--r-- root/root       914 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/qrhuld.aa
-rw-r--r-- root/root     34874 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/titin_hum.aa
-rw-r--r-- root/root     83286 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/titin_hum.seq
-rw-r--r-- root/root       934 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/vav_human.aa
-rw-r--r-- root/root       302 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/xurt8c.aa
-rw-r--r-- root/root       302 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/xurt8c.lc
-rw-r--r-- root/root       281 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/seq/xurtg.aa
drwxr-xr-x root/root         0 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/
-rw-r--r-- root/root       992 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/README
-rw-r--r-- root/root       536 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/create_seq_demo.sql
-rwxr-xr-x root/root      3227 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/join_up50.pl
-rw-r--r-- root/root       347 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/mysql_demo1.sql
-rw-r--r-- root/root       388 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/mysql_demo_pv.sql
-rwxr-xr-x root/root      3300 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/nr_to_sql.pl
-rw-r--r-- root/root       230 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/pirpsd.sql
-rw-r--r-- root/root       317 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/psql_demo.sql
-rw-r--r-- root/root       373 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/psql_demo1.sql
-rw-r--r-- root/root       343 2022-11-14 21:42 ./usr/share/doc/fasta3/examples/sql/psql_demo_pv.sql
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/fasta3/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/fasta3/data/
-rw-r--r-- root/root      2764 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_10.mat
-rw-r--r-- root/root      2548 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_120.mat
-rw-r--r-- root/root      2548 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_160.mat
-rw-r--r-- root/root      2546 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_20.mat
-rw-r--r-- root/root      2548 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_200.mat
-rw-r--r-- root/root      2546 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_40.mat
-rw-r--r-- root/root      2545 2022-11-14 21:42 ./usr/share/fasta3/data/VTML_80.mat
-rw-r--r-- root/root      1922 2022-11-14 21:42 ./usr/share/fasta3/data/blosum45.mat
-rw-r--r-- root/root      1921 2022-11-14 21:42 ./usr/share/fasta3/data/blosum50.mat
-rw-r--r-- root/root      1922 2022-11-14 21:42 ./usr/share/fasta3/data/blosum62.mat
-rw-r--r-- root/root      1924 2022-11-14 21:42 ./usr/share/fasta3/data/blosum80.mat
-rw-r--r-- root/root       976 2022-11-14 21:42 ./usr/share/fasta3/data/dna.mat
-rw-r--r-- root/root      2256 2022-11-14 21:42 ./usr/share/fasta3/data/idn_aa.mat
-rw-r--r-- root/root      2255 2022-11-14 21:42 ./usr/share/fasta3/data/md_10.mat
-rw-r--r-- root/root      2256 2022-11-14 21:42 ./usr/share/fasta3/data/md_20.mat
-rw-r--r-- root/root      2255 2022-11-14 21:42 ./usr/share/fasta3/data/md_40.mat
-rw-r--r-- root/root      1922 2022-11-14 21:42 ./usr/share/fasta3/data/pam120.mat
-rw-r--r-- root/root      1923 2022-11-14 21:42 ./usr/share/fasta3/data/pam250.mat
-rw-r--r-- root/root       998 2022-11-14 21:42 ./usr/share/fasta3/data/rna.mat
-rw-r--r-- root/root      2771 2022-11-14 21:42 ./usr/share/fasta3/data/vtml160.mat
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/fasta3/misc/
-rw-r--r-- root/root       424 2022-11-14 21:42 ./usr/share/fasta3/misc/README
-rwxr-xr-x root/root      3447 2022-11-14 21:42 ./usr/share/fasta3/misc/parse_m9.pl
-rwxr-xr-x root/root       367 2022-11-14 21:42 ./usr/share/fasta3/misc/res2R.pl
-rwxr-xr-x root/root      3177 2022-11-14 21:42 ./usr/share/fasta3/misc/shuffle_embed.pl
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/fasta3/scripts/
-rw-r--r-- root/root      5789 2022-11-14 21:42 ./usr/share/fasta3/scripts/README
-rw-r--r-- root/root      3182 2022-11-14 21:42 ./usr/share/fasta3/scripts/README.scripts
-rw-r--r-- root/root        76 2022-11-14 21:42 ./usr/share/fasta3/scripts/acc_examples
-rwxr-xr-x root/root     12539 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_exons_all.pl
-rwxr-xr-x root/root      7233 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_exons_ens.pl
-rwxr-xr-x root/root      4941 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_exons_ncbi.pl
-rwxr-xr-x root/root      8535 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_exons_up_sql.pl
-rwxr-xr-x root/root     12227 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_exons_up_sql_www.pl
-rwxr-xr-x root/root      9106 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_exons_up_www.pl
-rwxr-xr-x root/root     15933 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_feats2ipr.pl
-rwxr-xr-x root/root     15996 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_feats2ipr_e.pl
-rwxr-xr-x root/root     13524 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_feats_up_sql.pl
-rwxr-xr-x root/root     12846 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_feats_up_www2.pl
-rwxr-xr-x root/root     14551 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_ipr_www.pl
-rwxr-xr-x root/root      9521 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_pdb_cath.pl
-rwxr-xr-x root/root      8406 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_pdb_vast.pl
-rwxr-xr-x root/root     24113 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_pfam28.pl
-rwxr-xr-x root/root     27702 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_pfam30_tmptbl.pl
-rwxr-xr-x root/root     27278 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_pfam_sql.pl
-rwxr-xr-x root/root      8244 2022-11-14 21:42 ./usr/share/fasta3/scripts/ann_pfam_sql.py
-rwxr-xr-x root/root     20591 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_pfam_www.pl
-rwxr-xr-x root/root      7871 2022-11-14 21:42 ./usr/share/fasta3/scripts/ann_pfam_www.py
-rw-r--r-- root/root       321 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_script_list
-rwxr-xr-x root/root     23659 2024-05-21 04:15 ./usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl
-rwxr-xr-x root/root     44912 2024-05-21 04:15 ./usr/share/fasta3/scripts/annot_blast_btop2.pl
-rwxr-xr-x root/root     25321 2024-05-21 04:15 ./usr/share/fasta3/scripts/annot_blast_btop3.py
-rwxr-xr-x root/root     27067 2024-05-21 04:15 ./usr/share/fasta3/scripts/annot_blast_btop4.py
-rwxr-xr-x root/root      3017 2024-05-21 04:15 ./usr/share/fasta3/scripts/blastp_annot_cmd.sh
-rwxr-xr-x root/root       753 2024-05-21 04:15 ./usr/share/fasta3/scripts/blastp_cmd.sh
-rwxr-xr-x root/root      4583 2022-11-14 21:42 ./usr/share/fasta3/scripts/color_defs.pl
-rwxr-xr-x root/root      4564 2024-05-21 04:15 ./usr/share/fasta3/scripts/exp_up_ensg.pl
-rwxr-xr-x root/root      3275 2024-05-21 04:15 ./usr/share/fasta3/scripts/expand_links.pl
-rwxr-xr-x root/root      5572 2024-05-21 04:15 ./usr/share/fasta3/scripts/expand_refseq_isoforms.pl
-rwxr-xr-x root/root      2576 2024-05-21 04:15 ./usr/share/fasta3/scripts/expand_uniref50.pl
-rwxr-xr-x root/root      6043 2024-05-21 04:15 ./usr/share/fasta3/scripts/expand_up_isoforms.pl
-rwxr-xr-x root/root      1590 2024-05-21 04:15 ./usr/share/fasta3/scripts/fasta_annot_cmd.sh
-rwxr-xr-x root/root      1676 2024-05-21 04:15 ./usr/share/fasta3/scripts/get_genome_seq.py
-rwxr-xr-x root/root      1669 2024-05-21 04:15 ./usr/share/fasta3/scripts/get_protein.py
-rwxr-xr-x root/root      1722 2024-05-21 04:15 ./usr/share/fasta3/scripts/get_protein_sql.py
-rwxr-xr-x root/root      3659 2024-05-21 04:15 ./usr/share/fasta3/scripts/get_protein_sql_www.py
-rwxr-xr-x root/root       553 2024-05-21 04:15 ./usr/share/fasta3/scripts/get_refseq.py
-rwxr-xr-x root/root       409 2024-05-21 04:15 ./usr/share/fasta3/scripts/get_uniprot.py
-rwxr-xr-x root/root      1188 2024-05-21 04:15 ./usr/share/fasta3/scripts/get_up_prot_iso_sql.py
-rwxr-xr-x root/root      9405 2024-05-21 04:15 ./usr/share/fasta3/scripts/lav2plt.pl
-rwxr-xr-x root/root     15015 2024-05-21 04:15 ./usr/share/fasta3/scripts/lavplt_ps.pl
-rwxr-xr-x root/root     13106 2024-05-21 04:15 ./usr/share/fasta3/scripts/lavplt_svg.pl
-rwxr-xr-x root/root      1909 2024-05-21 04:15 ./usr/share/fasta3/scripts/links2sql.pl
-rwxr-xr-x root/root      9771 2022-11-14 21:42 ./usr/share/fasta3/scripts/m8CBl_to_plot2.R
-rwxr-xr-x root/root     11092 2024-05-21 04:15 ./usr/share/fasta3/scripts/m8_btop_msa.pl
-rwxr-xr-x root/root     18926 2024-05-21 04:15 ./usr/share/fasta3/scripts/m9B_btop_msa.pl
-rwxr-xr-x root/root     16976 2024-05-21 04:15 ./usr/share/fasta3/scripts/map_exon_coords.py
-rwxr-xr-x root/root      7659 2024-05-21 04:15 ./usr/share/fasta3/scripts/merge_blast_btab.pl
-rwxr-xr-x root/root      9415 2024-05-21 04:15 ./usr/share/fasta3/scripts/merge_fasta_btab.pl
-rwxr-xr-x root/root     19093 2022-11-14 21:42 ./usr/share/fasta3/scripts/plot_domain2t.cgi
-rwxr-xr-x root/root      5286 2024-05-21 04:15 ./usr/share/fasta3/scripts/relabel_domains.py
-rwxr-xr-x root/root     30354 2024-05-21 04:15 ./usr/share/fasta3/scripts/rename_exons.py
-rwxr-xr-x root/root      3042 2024-05-21 04:15 ./usr/share/fasta3/scripts/summ_domain_ident.pl
-rwxr-xr-x root/root       706 2024-05-21 04:15 ./usr/share/fasta3/scripts/test_ann_scripts.sh
-rwxr-xr-x root/root      2978 2024-05-21 04:15 ./usr/share/fasta3/scripts/test_py.sh
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/man/
drwxr-xr-x root/root         0 2024-05-21 04:15 ./usr/share/man/man1/
-rw-r--r-- root/root      7358 2024-05-21 04:15 ./usr/share/man/man1/fasta36.1.gz
-rw-r--r-- root/root      2195 2024-05-21 04:15 ./usr/share/man/man1/fastf3.1.gz
-rw-r--r-- root/root      2119 2024-05-21 04:15 ./usr/share/man/man1/fasts3.1.gz
-rw-r--r-- root/root       523 2024-05-21 04:15 ./usr/share/man/man1/map_db.1.gz
-rw-r--r-- root/root      2146 2024-05-21 04:15 ./usr/share/man/man1/prss3.1.gz
-rw-r--r-- root/root       402 2024-05-21 04:15 ./usr/share/man/man1/ps_lav.1.gz


+------------------------------------------------------------------------------+
| Post Build                                                                   |
+------------------------------------------------------------------------------+


+------------------------------------------------------------------------------+
| Cleanup                                                                      |
+------------------------------------------------------------------------------+

Purging /<<BUILDDIR>>
Not cleaning session: cloned chroot in use

+------------------------------------------------------------------------------+
| Summary                                                                      |
+------------------------------------------------------------------------------+

Build Architecture: armhf
Build Type: any
Build-Space: 56080
Build-Time: 331
Distribution: trixie-staging
Host Architecture: armhf
Install-Time: 5
Job: fasta3_36.3.8i.14-Nov-2020-1
Machine Architecture: arm64
Package: fasta3
Package-Time: 345
Source-Version: 36.3.8i.14-Nov-2020-1
Space: 56080
Status: successful
Version: 36.3.8i.14-Nov-2020-1+b6
--------------------------------------------------------------------------------
Finished at 2024-05-21T04:20:46Z
Build needed 00:05:45, 56080k disk space