Raspbian Package Auto-Building

Build log for fasta3 (36.3.8h.2020-02-11-4+b6) on armhf

fasta336.3.8h.2020-02-11-4+b6armhf → 2022-06-12 23:28:40

sbuild (Debian sbuild) 0.71.0 (24 Aug 2016) on testbuildd

+==============================================================================+
| fasta3 36.3.8h.2020-02-11-4+b6 (armhf)       Sun, 12 Jun 2022 22:45:17 +0000 |
+==============================================================================+

Package: fasta3
Version: 36.3.8h.2020-02-11-4+b6
Source Version: 36.3.8h.2020-02-11-4
Distribution: bookworm-staging
Machine Architecture: armhf
Host Architecture: armhf
Build Architecture: armhf

I: NOTICE: Log filtering will replace 'var/lib/schroot/mount/bookworm-staging-armhf-sbuild-c1c27c2c-cab8-4282-8448-6f832c3c6e74' with '<<CHROOT>>'

+------------------------------------------------------------------------------+
| Update chroot                                                                |
+------------------------------------------------------------------------------+

Get:1 http://172.17.4.1/private bookworm-staging InRelease [11.3 kB]
Get:2 http://172.17.4.1/private bookworm-staging/main Sources [13.0 MB]
Get:3 http://172.17.4.1/private bookworm-staging/main armhf Packages [14.0 MB]
Fetched 27.0 MB in 28s (951 kB/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
W: http://172.17.4.1/private/dists/bookworm-staging/InRelease: Key is stored in legacy trusted.gpg keyring (/etc/apt/trusted.gpg), see the DEPRECATION section in apt-key(8) for details.

+------------------------------------------------------------------------------+
| Fetch source files                                                           |
+------------------------------------------------------------------------------+


Check APT
---------

Checking available source versions...

Download source files with APT
------------------------------

Reading package lists...
NOTICE: 'fasta3' packaging is maintained in the 'Git' version control system at:
https://salsa.debian.org/med-team/fasta3.git
Please use:
git clone https://salsa.debian.org/med-team/fasta3.git
to retrieve the latest (possibly unreleased) updates to the package.
Need to get 1271 kB of source archives.
Get:1 http://172.17.4.1/private bookworm-staging/main fasta3 36.3.8h.2020-02-11-4 (dsc) [2217 B]
Get:2 http://172.17.4.1/private bookworm-staging/main fasta3 36.3.8h.2020-02-11-4 (tar) [1257 kB]
Get:3 http://172.17.4.1/private bookworm-staging/main fasta3 36.3.8h.2020-02-11-4 (diff) [11.8 kB]
Fetched 1271 kB in 0s (3697 kB/s)
Download complete and in download only mode
I: NOTICE: Log filtering will replace 'build/fasta3-Nnhytd/fasta3-36.3.8h.2020-02-11' with '<<PKGBUILDDIR>>'
I: NOTICE: Log filtering will replace 'build/fasta3-Nnhytd' with '<<BUILDDIR>>'

+------------------------------------------------------------------------------+
| Install build-essential                                                      |
+------------------------------------------------------------------------------+


Setup apt archive
-----------------

Merged Build-Depends: build-essential, fakeroot
Filtered Build-Depends: build-essential, fakeroot
dpkg-deb: building package 'sbuild-build-depends-core-dummy' in '/<<BUILDDIR>>/resolver-P0M8cB/apt_archive/sbuild-build-depends-core-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning:   sbuild-build-depends-core-dummy
dpkg-scanpackages: info: Wrote 1 entries to output Packages file.
gpg: keybox '/<<BUILDDIR>>/resolver-P0M8cB/gpg/pubring.kbx' created
gpg: /<<BUILDDIR>>/resolver-P0M8cB/gpg/trustdb.gpg: trustdb created
gpg: key 35506D9A48F77B2E: public key "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" imported
gpg: Total number processed: 1
gpg:               imported: 1
gpg: key 35506D9A48F77B2E: "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" not changed
gpg: key 35506D9A48F77B2E: secret key imported
gpg: Total number processed: 1
gpg:              unchanged: 1
gpg:       secret keys read: 1
gpg:   secret keys imported: 1
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ Release [957 B]
Get:3 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ Sources [349 B]
Get:5 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ Packages [431 B]
Fetched 2107 B in 1s (2863 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...

Install core build dependencies (apt-based resolver)
----------------------------------------------------

Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
  netbase sensible-utils
Use 'apt autoremove' to remove them.
The following NEW packages will be installed:
  sbuild-build-depends-core-dummy
0 upgraded, 1 newly installed, 0 to remove and 72 not upgraded.
Need to get 852 B of archives.
After this operation, 0 B of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ sbuild-build-depends-core-dummy 0.invalid.0 [852 B]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 852 B in 0s (22.7 kB/s)
Selecting previously unselected package sbuild-build-depends-core-dummy.
(Reading database ... 12621 files and directories currently installed.)
Preparing to unpack .../sbuild-build-depends-core-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-core-dummy (0.invalid.0) ...
Setting up sbuild-build-depends-core-dummy (0.invalid.0) ...
W: No sandbox user '_apt' on the system, can not drop privileges

+------------------------------------------------------------------------------+
| Check architectures                                                          |
+------------------------------------------------------------------------------+

Arch check ok (armhf included in any all)

+------------------------------------------------------------------------------+
| Install package build dependencies                                           |
+------------------------------------------------------------------------------+


Setup apt archive
-----------------

Merged Build-Depends: debhelper-compat (= 13), libsimde-dev
Filtered Build-Depends: debhelper-compat (= 13), libsimde-dev
dpkg-deb: building package 'sbuild-build-depends-fasta3-dummy' in '/<<BUILDDIR>>/resolver-P0M8cB/apt_archive/sbuild-build-depends-fasta3-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning:   sbuild-build-depends-core-dummy sbuild-build-depends-fasta3-dummy
dpkg-scanpackages: info: Wrote 2 entries to output Packages file.
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ Release [963 B]
Get:3 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ Sources [498 B]
Get:5 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ Packages [576 B]
Fetched 2407 B in 1s (3338 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...

Install fasta3 build dependencies (apt-based resolver)
------------------------------------------------------

Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following package was automatically installed and is no longer required:
  netbase
Use 'apt autoremove' to remove it.
The following additional packages will be installed:
  autoconf automake autopoint autotools-dev bsdextrautils debhelper
  dh-autoreconf dh-strip-nondeterminism dwz file gettext gettext-base
  groff-base intltool-debian libarchive-zip-perl libdebhelper-perl libelf1
  libfile-stripnondeterminism-perl libicu71 libmagic-mgc libmagic1
  libpipeline1 libsigsegv2 libsimde-dev libsub-override-perl libtool
  libuchardet0 libxml2 m4 man-db po-debconf
Suggested packages:
  autoconf-archive gnu-standards autoconf-doc dh-make gettext-doc
  libasprintf-dev libgettextpo-dev groff libtool-doc gfortran
  | fortran95-compiler gcj-jdk m4-doc apparmor less www-browser
  libmail-box-perl
Recommended packages:
  curl | wget | lynx libarchive-cpio-perl libltdl-dev libmail-sendmail-perl
The following NEW packages will be installed:
  autoconf automake autopoint autotools-dev bsdextrautils debhelper
  dh-autoreconf dh-strip-nondeterminism dwz file gettext gettext-base
  groff-base intltool-debian libarchive-zip-perl libdebhelper-perl libelf1
  libfile-stripnondeterminism-perl libicu71 libmagic-mgc libmagic1
  libpipeline1 libsigsegv2 libsimde-dev libsub-override-perl libtool
  libuchardet0 libxml2 m4 man-db po-debconf sbuild-build-depends-fasta3-dummy
0 upgraded, 32 newly installed, 0 to remove and 72 not upgraded.
Need to get 18.4 MB of archives.
After this operation, 72.0 MB of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-P0M8cB/apt_archive ./ sbuild-build-depends-fasta3-dummy 0.invalid.0 [868 B]
Get:2 http://172.17.4.1/private bookworm-staging/main armhf libuchardet0 armhf 0.0.7-1 [65.0 kB]
Get:3 http://172.17.4.1/private bookworm-staging/main armhf groff-base armhf 1.22.4-8 [793 kB]
Get:4 http://172.17.4.1/private bookworm-staging/main armhf bsdextrautils armhf 2.38-4 [137 kB]
Get:5 http://172.17.4.1/private bookworm-staging/main armhf libpipeline1 armhf 1.5.6-1 [33.7 kB]
Get:6 http://172.17.4.1/private bookworm-staging/main armhf man-db armhf 2.10.2-1 [1362 kB]
Get:7 http://172.17.4.1/private bookworm-staging/main armhf libmagic-mgc armhf 1:5.41-4 [295 kB]
Get:8 http://172.17.4.1/private bookworm-staging/main armhf libmagic1 armhf 1:5.41-4 [120 kB]
Get:9 http://172.17.4.1/private bookworm-staging/main armhf file armhf 1:5.41-4 [65.8 kB]
Get:10 http://172.17.4.1/private bookworm-staging/main armhf gettext-base armhf 0.21-6 [171 kB]
Get:11 http://172.17.4.1/private bookworm-staging/main armhf libsigsegv2 armhf 2.14-1 [36.6 kB]
Get:12 http://172.17.4.1/private bookworm-staging/main armhf m4 armhf 1.4.18-5 [186 kB]
Get:13 http://172.17.4.1/private bookworm-staging/main armhf autoconf all 2.71-2 [343 kB]
Get:14 http://172.17.4.1/private bookworm-staging/main armhf autotools-dev all 20220109.1 [51.6 kB]
Get:15 http://172.17.4.1/private bookworm-staging/main armhf automake all 1:1.16.5-1.3 [823 kB]
Get:16 http://172.17.4.1/private bookworm-staging/main armhf autopoint all 0.21-6 [510 kB]
Get:17 http://172.17.4.1/private bookworm-staging/main armhf libdebhelper-perl all 13.7.1 [195 kB]
Get:18 http://172.17.4.1/private bookworm-staging/main armhf libtool all 2.4.7-4 [526 kB]
Get:19 http://172.17.4.1/private bookworm-staging/main armhf dh-autoreconf all 20 [17.1 kB]
Get:20 http://172.17.4.1/private bookworm-staging/main armhf libarchive-zip-perl all 1.68-1 [104 kB]
Get:21 http://172.17.4.1/private bookworm-staging/main armhf libsub-override-perl all 0.09-2 [10.2 kB]
Get:22 http://172.17.4.1/private bookworm-staging/main armhf libfile-stripnondeterminism-perl all 1.13.0-1 [26.6 kB]
Get:23 http://172.17.4.1/private bookworm-staging/main armhf dh-strip-nondeterminism all 1.13.0-1 [15.8 kB]
Get:24 http://172.17.4.1/private bookworm-staging/main armhf libelf1 armhf 0.187-1 [175 kB]
Get:25 http://172.17.4.1/private bookworm-staging/main armhf dwz armhf 0.14-1 [83.0 kB]
Get:26 http://172.17.4.1/private bookworm-staging/main armhf libicu71 armhf 71.1-3 [8855 kB]
Get:27 http://172.17.4.1/private bookworm-staging/main armhf libxml2 armhf 2.9.14+dfsg-1 [591 kB]
Get:28 http://172.17.4.1/private bookworm-staging/main armhf gettext armhf 0.21-6 [1214 kB]
Get:29 http://172.17.4.1/private bookworm-staging/main armhf intltool-debian all 0.35.0+20060710.5 [26.8 kB]
Get:30 http://172.17.4.1/private bookworm-staging/main armhf po-debconf all 1.0.21+nmu1 [248 kB]
Get:31 http://172.17.4.1/private bookworm-staging/main armhf debhelper all 13.7.1 [1071 kB]
Get:32 http://172.17.4.1/private bookworm-staging/main armhf libsimde-dev all 0.7.2-6 [259 kB]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 18.4 MB in 3s (5520 kB/s)
Selecting previously unselected package libuchardet0:armhf.
(Reading database ... 12621 files and directories currently installed.)
Preparing to unpack .../00-libuchardet0_0.0.7-1_armhf.deb ...
Unpacking libuchardet0:armhf (0.0.7-1) ...
Selecting previously unselected package groff-base.
Preparing to unpack .../01-groff-base_1.22.4-8_armhf.deb ...
Unpacking groff-base (1.22.4-8) ...
Selecting previously unselected package bsdextrautils.
Preparing to unpack .../02-bsdextrautils_2.38-4_armhf.deb ...
Unpacking bsdextrautils (2.38-4) ...
Selecting previously unselected package libpipeline1:armhf.
Preparing to unpack .../03-libpipeline1_1.5.6-1_armhf.deb ...
Unpacking libpipeline1:armhf (1.5.6-1) ...
Selecting previously unselected package man-db.
Preparing to unpack .../04-man-db_2.10.2-1_armhf.deb ...
Unpacking man-db (2.10.2-1) ...
Selecting previously unselected package libmagic-mgc.
Preparing to unpack .../05-libmagic-mgc_1%3a5.41-4_armhf.deb ...
Unpacking libmagic-mgc (1:5.41-4) ...
Selecting previously unselected package libmagic1:armhf.
Preparing to unpack .../06-libmagic1_1%3a5.41-4_armhf.deb ...
Unpacking libmagic1:armhf (1:5.41-4) ...
Selecting previously unselected package file.
Preparing to unpack .../07-file_1%3a5.41-4_armhf.deb ...
Unpacking file (1:5.41-4) ...
Selecting previously unselected package gettext-base.
Preparing to unpack .../08-gettext-base_0.21-6_armhf.deb ...
Unpacking gettext-base (0.21-6) ...
Selecting previously unselected package libsigsegv2:armhf.
Preparing to unpack .../09-libsigsegv2_2.14-1_armhf.deb ...
Unpacking libsigsegv2:armhf (2.14-1) ...
Selecting previously unselected package m4.
Preparing to unpack .../10-m4_1.4.18-5_armhf.deb ...
Unpacking m4 (1.4.18-5) ...
Selecting previously unselected package autoconf.
Preparing to unpack .../11-autoconf_2.71-2_all.deb ...
Unpacking autoconf (2.71-2) ...
Selecting previously unselected package autotools-dev.
Preparing to unpack .../12-autotools-dev_20220109.1_all.deb ...
Unpacking autotools-dev (20220109.1) ...
Selecting previously unselected package automake.
Preparing to unpack .../13-automake_1%3a1.16.5-1.3_all.deb ...
Unpacking automake (1:1.16.5-1.3) ...
Selecting previously unselected package autopoint.
Preparing to unpack .../14-autopoint_0.21-6_all.deb ...
Unpacking autopoint (0.21-6) ...
Selecting previously unselected package libdebhelper-perl.
Preparing to unpack .../15-libdebhelper-perl_13.7.1_all.deb ...
Unpacking libdebhelper-perl (13.7.1) ...
Selecting previously unselected package libtool.
Preparing to unpack .../16-libtool_2.4.7-4_all.deb ...
Unpacking libtool (2.4.7-4) ...
Selecting previously unselected package dh-autoreconf.
Preparing to unpack .../17-dh-autoreconf_20_all.deb ...
Unpacking dh-autoreconf (20) ...
Selecting previously unselected package libarchive-zip-perl.
Preparing to unpack .../18-libarchive-zip-perl_1.68-1_all.deb ...
Unpacking libarchive-zip-perl (1.68-1) ...
Selecting previously unselected package libsub-override-perl.
Preparing to unpack .../19-libsub-override-perl_0.09-2_all.deb ...
Unpacking libsub-override-perl (0.09-2) ...
Selecting previously unselected package libfile-stripnondeterminism-perl.
Preparing to unpack .../20-libfile-stripnondeterminism-perl_1.13.0-1_all.deb ...
Unpacking libfile-stripnondeterminism-perl (1.13.0-1) ...
Selecting previously unselected package dh-strip-nondeterminism.
Preparing to unpack .../21-dh-strip-nondeterminism_1.13.0-1_all.deb ...
Unpacking dh-strip-nondeterminism (1.13.0-1) ...
Selecting previously unselected package libelf1:armhf.
Preparing to unpack .../22-libelf1_0.187-1_armhf.deb ...
Unpacking libelf1:armhf (0.187-1) ...
Selecting previously unselected package dwz.
Preparing to unpack .../23-dwz_0.14-1_armhf.deb ...
Unpacking dwz (0.14-1) ...
Selecting previously unselected package libicu71:armhf.
Preparing to unpack .../24-libicu71_71.1-3_armhf.deb ...
Unpacking libicu71:armhf (71.1-3) ...
Selecting previously unselected package libxml2:armhf.
Preparing to unpack .../25-libxml2_2.9.14+dfsg-1_armhf.deb ...
Unpacking libxml2:armhf (2.9.14+dfsg-1) ...
Selecting previously unselected package gettext.
Preparing to unpack .../26-gettext_0.21-6_armhf.deb ...
Unpacking gettext (0.21-6) ...
Selecting previously unselected package intltool-debian.
Preparing to unpack .../27-intltool-debian_0.35.0+20060710.5_all.deb ...
Unpacking intltool-debian (0.35.0+20060710.5) ...
Selecting previously unselected package po-debconf.
Preparing to unpack .../28-po-debconf_1.0.21+nmu1_all.deb ...
Unpacking po-debconf (1.0.21+nmu1) ...
Selecting previously unselected package debhelper.
Preparing to unpack .../29-debhelper_13.7.1_all.deb ...
Unpacking debhelper (13.7.1) ...
Selecting previously unselected package libsimde-dev.
Preparing to unpack .../30-libsimde-dev_0.7.2-6_all.deb ...
Unpacking libsimde-dev (0.7.2-6) ...
Selecting previously unselected package sbuild-build-depends-fasta3-dummy.
Preparing to unpack .../31-sbuild-build-depends-fasta3-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-fasta3-dummy (0.invalid.0) ...
Setting up libpipeline1:armhf (1.5.6-1) ...
Setting up libsimde-dev (0.7.2-6) ...
Setting up libicu71:armhf (71.1-3) ...
Setting up bsdextrautils (2.38-4) ...
Setting up libmagic-mgc (1:5.41-4) ...
Setting up libarchive-zip-perl (1.68-1) ...
Setting up libdebhelper-perl (13.7.1) ...
Setting up libmagic1:armhf (1:5.41-4) ...
Setting up gettext-base (0.21-6) ...
Setting up file (1:5.41-4) ...
Setting up autotools-dev (20220109.1) ...
Setting up libsigsegv2:armhf (2.14-1) ...
Setting up autopoint (0.21-6) ...
Setting up libuchardet0:armhf (0.0.7-1) ...
Setting up libsub-override-perl (0.09-2) ...
Setting up libelf1:armhf (0.187-1) ...
Setting up libxml2:armhf (2.9.14+dfsg-1) ...
Setting up libfile-stripnondeterminism-perl (1.13.0-1) ...
Setting up gettext (0.21-6) ...
Setting up libtool (2.4.7-4) ...
Setting up m4 (1.4.18-5) ...
Setting up intltool-debian (0.35.0+20060710.5) ...
Setting up autoconf (2.71-2) ...
Setting up dh-strip-nondeterminism (1.13.0-1) ...
Setting up dwz (0.14-1) ...
Setting up groff-base (1.22.4-8) ...
Setting up automake (1:1.16.5-1.3) ...
update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode
Setting up po-debconf (1.0.21+nmu1) ...
Setting up man-db (2.10.2-1) ...
Not building database; man-db/auto-update is not 'true'.
Setting up dh-autoreconf (20) ...
Setting up debhelper (13.7.1) ...
Setting up sbuild-build-depends-fasta3-dummy (0.invalid.0) ...
Processing triggers for libc-bin (2.33-7+rpi1) ...
W: No sandbox user '_apt' on the system, can not drop privileges

+------------------------------------------------------------------------------+
| Build environment                                                            |
+------------------------------------------------------------------------------+

Kernel: Linux 4.9.0-0.bpo.6-armmp armhf (armv7l)
Toolchain package versions: binutils_2.38-3+rpi1 dpkg-dev_1.21.7+rpi1 g++-11_11.2.0-20+rpi1 gcc-11_11.2.0-20+rpi1 libc6-dev_2.33-7+rpi1 libstdc++-11-dev_11.2.0-20+rpi1 libstdc++6_12-20220319-1+rpi1 linux-libc-dev_5.16.18-1+rpi1
Package versions: adduser_3.121 apt_2.4.5 autoconf_2.71-2 automake_1:1.16.5-1.3 autopoint_0.21-6 autotools-dev_20220109.1 base-files_12.2+rpi1 base-passwd_3.5.52 bash_5.1-6 binutils_2.38-3+rpi1 binutils-arm-linux-gnueabihf_2.38-3+rpi1 binutils-common_2.38-3+rpi1 bsdextrautils_2.38-4 bsdutils_1:2.38-4 build-essential_12.9 bzip2_1.0.8-5 coreutils_8.32-4.1 cpp_4:11.2.0-2+rpi1 cpp-11_11.2.0-20+rpi1 dash_0.5.11+git20210903+057cd650a4ed-8 debconf_1.5.79 debhelper_13.7.1 debianutils_5.7-0.1 dh-autoreconf_20 dh-strip-nondeterminism_1.13.0-1 diffutils_1:3.7-5 dirmngr_2.2.27-3+b1 dpkg_1.21.7+rpi1 dpkg-dev_1.21.7+rpi1 dwz_0.14-1 e2fsprogs_1.46.5-2 fakeroot_1.28-1 file_1:5.41-4 findutils_4.9.0-2 g++_4:11.2.0-2+rpi1 g++-11_11.2.0-20+rpi1 gcc_4:11.2.0-2+rpi1 gcc-11_11.2.0-20+rpi1 gcc-11-base_11.2.0-20+rpi1 gcc-12-base_12-20220319-1+rpi1 gcc-7-base_7.5.0-6+rpi1+b2 gcc-8-base_8.4.0-7+rpi1 gcc-9-base_9.4.0-2+rpi1 gettext_0.21-6 gettext-base_0.21-6 gnupg_2.2.27-3 gnupg-l10n_2.2.27-3 gnupg-utils_2.2.27-3+b1 gpg_2.2.27-3+b1 gpg-agent_2.2.27-3+b1 gpg-wks-client_2.2.27-3+b1 gpg-wks-server_2.2.27-3+b1 gpgconf_2.2.27-3+b1 gpgsm_2.2.27-3+b1 gpgv_2.2.27-3+b1 grep_3.7-1 groff-base_1.22.4-8 gzip_1.12-1 hostname_3.23 init-system-helpers_1.62 intltool-debian_0.35.0+20060710.5 libacl1_2.3.1-1 libapt-pkg6.0_2.4.5 libarchive-zip-perl_1.68-1 libasan6_11.2.0-20+rpi1 libassuan0_2.5.5-1 libatomic1_12-20220319-1+rpi1 libattr1_1:2.5.1-1 libaudit-common_1:3.0.7-1 libaudit1_1:3.0.7-1+b1 libbinutils_2.38-3+rpi1 libblkid1_2.38-4 libbz2-1.0_1.0.8-5 libc-bin_2.33-7+rpi1 libc-dev-bin_2.33-7+rpi1 libc6_2.33-7+rpi1 libc6-dev_2.33-7+rpi1 libcap-ng0_0.7.9-2.2+b2 libcap2_1:2.44-1 libcc1-0_12-20220319-1+rpi1 libcom-err2_1.46.5-2 libcrypt-dev_1:4.4.27-1.1 libcrypt1_1:4.4.27-1.1 libctf-nobfd0_2.38-3+rpi1 libctf0_2.38-3+rpi1 libdb5.3_5.3.28+dfsg1-0.8 libdebconfclient0_0.262 libdebhelper-perl_13.7.1 libdpkg-perl_1.21.7+rpi1 libelf1_0.187-1 libext2fs2_1.46.5-2 libfakeroot_1.28-1 libffi8_3.4.2-4 libfile-stripnondeterminism-perl_1.13.0-1 libgcc-11-dev_11.2.0-20+rpi1 libgcc-s1_12-20220319-1+rpi1 libgcrypt20_1.10.1-2 libgdbm-compat4_1.23-1 libgdbm6_1.23-1 libgmp10_2:6.2.1+dfsg-3 libgnutls30_3.7.4-2 libgomp1_12-20220319-1+rpi1 libgpg-error0_1.43-3 libgssapi-krb5-2_1.19.2-2+b2 libhogweed6_3.7.3-1 libicu71_71.1-3 libidn2-0_2.3.2-2 libisl23_0.24-2 libk5crypto3_1.19.2-2+b2 libkeyutils1_1.6.1-3+rpi1 libkrb5-3_1.19.2-2+b2 libkrb5support0_1.19.2-2+b2 libksba8_1.6.0-2 libldap-2.5-0_2.5.11+dfsg-1+rpi1 liblz4-1_1.9.3-2 liblzma5_5.2.5-2.1 libmagic-mgc_1:5.41-4 libmagic1_1:5.41-4 libmount1_2.38-4 libmpc3_1.2.1-2 libmpfr6_4.1.0-3 libncursesw6_6.3-2 libnettle8_3.7.3-1 libnpth0_1.6-3 libnsl-dev_1.3.0-2 libnsl2_1.3.0-2 libp11-kit0_0.24.1-1 libpam-modules_1.4.0-11 libpam-modules-bin_1.4.0-11 libpam-runtime_1.4.0-11 libpam0g_1.4.0-11 libpcre2-8-0_10.39-4 libpcre3_2:8.39-14 libperl5.34_5.34.0-4 libpipeline1_1.5.6-1 libreadline8_8.1.2-1.2 libsasl2-2_2.1.28+dfsg-4 libsasl2-modules-db_2.1.28+dfsg-4 libseccomp2_2.5.3-2+rpi1+b1 libselinux1_3.3-1+b1 libsemanage-common_3.3-1 libsemanage2_3.3-1+b1 libsepol1_3.1-1 libsepol2_3.3-1 libsigsegv2_2.14-1 libsimde-dev_0.7.2-6 libsmartcols1_2.38-4 libsqlite3-0_3.38.2-1 libss2_1.46.5-2 libssl1.1_1.1.1n-1 libstdc++-11-dev_11.2.0-20+rpi1 libstdc++6_12-20220319-1+rpi1 libsub-override-perl_0.09-2 libsystemd0_250.4-1+rpi1 libtasn1-6_4.18.0-4 libtinfo6_6.3-2 libtirpc-common_1.3.2-2 libtirpc-dev_1.3.2-2 libtirpc3_1.3.2-2 libtool_2.4.7-4 libubsan1_12-20220319-1+rpi1 libuchardet0_0.0.7-1 libudev1_250.4-1+rpi1 libunistring2_1.0-1 libuuid1_2.38-4 libxml2_2.9.14+dfsg-1 libxxhash0_0.8.1-1 libzstd1_1.5.2+dfsg-1 linux-libc-dev_5.16.18-1+rpi1 login_1:4.11.1+dfsg1-2 logsave_1.46.5-2 lsb-base_11.1.0+rpi1 m4_1.4.18-5 make_4.3-4.1 man-db_2.10.2-1 mawk_1.3.4.20200120-3 mount_2.38-4 ncurses-base_6.3-2 ncurses-bin_6.3-2 netbase_6.3 passwd_1:4.11.1+dfsg1-2 patch_2.7.6-7 perl_5.34.0-4 perl-base_5.34.0-4 perl-modules-5.34_5.34.0-4 pinentry-curses_1.1.0-4 po-debconf_1.0.21+nmu1 raspbian-archive-keyring_20120528.2 readline-common_8.1.2-1.2 rpcsvc-proto_1.4.2-4 sbuild-build-depends-core-dummy_0.invalid.0 sbuild-build-depends-fasta3-dummy_0.invalid.0 sed_4.8-1 sensible-utils_0.0.17 sysvinit-utils_3.03-1 tar_1.34+dfsg-1 tzdata_2022a-1 util-linux_2.37.3-1 xz-utils_5.2.5-2.1 zlib1g_1:1.2.11.dfsg-4

+------------------------------------------------------------------------------+
| Build                                                                        |
+------------------------------------------------------------------------------+


Unpack source
-------------

gpgv: unknown type of key resource 'trustedkeys.kbx'
gpgv: keyblock resource '/tmp/dpkg-verify-sig._FGQc4rd/trustedkeys.kbx': General error
gpgv: Signature made Thu Sep  9 07:45:51 2021 UTC
gpgv:                using RSA key F1F007320A035541F0A663CA578A0494D1C646D1
gpgv:                issuer "tille@debian.org"
gpgv: Can't check signature: No public key
dpkg-source: warning: cannot verify signature ./fasta3_36.3.8h.2020-02-11-4.dsc
dpkg-source: info: extracting fasta3 in /<<PKGBUILDDIR>>
dpkg-source: info: unpacking fasta3_36.3.8h.2020-02-11.orig.tar.gz
dpkg-source: info: unpacking fasta3_36.3.8h.2020-02-11-4.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying Makefile.patch
dpkg-source: info: applying simde
dpkg-source: info: applying local_tests
dpkg-source: info: applying adjust-scripts

Check disc space
----------------

Sufficient free space for build

Hack binNMU version
-------------------

Created changelog entry for binNMU version 36.3.8h.2020-02-11-4+b6

User Environment
----------------

APT_CONFIG=/var/lib/sbuild/apt.conf
DEB_BUILD_OPTIONS=parallel=4
HOME=/sbuild-nonexistent
LC_ALL=POSIX
LOGNAME=buildd
PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games
SCHROOT_ALIAS_NAME=bookworm-staging-armhf-sbuild
SCHROOT_CHROOT_NAME=bookworm-staging-armhf-sbuild
SCHROOT_COMMAND=env
SCHROOT_GID=109
SCHROOT_GROUP=buildd
SCHROOT_SESSION_ID=bookworm-staging-armhf-sbuild-c1c27c2c-cab8-4282-8448-6f832c3c6e74
SCHROOT_UID=104
SCHROOT_USER=buildd
SHELL=/bin/sh
TERM=xterm
USER=buildd

dpkg-buildpackage
-----------------

dpkg-buildpackage: info: source package fasta3
dpkg-buildpackage: info: source version 36.3.8h.2020-02-11-4+b6
dpkg-buildpackage: info: source distribution bookworm-staging
 dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
 debian/rules clean
dh clean --sourcedirectory src
   debian/rules override_dh_auto_clean
make[1]: Entering directory '/<<PKGBUILDDIR>>'
if [ -d src ]; then cd src && /usr/bin/make -f "../make/Makefile.linux64" clean-up; fi
make[2]: Entering directory '/<<PKGBUILDDIR>>/src'
rm -f *.o  fasta36 ssearch36 lalign36 fasts36 fastx36 tfastx36 fasty36 tfasty36 tfasts36 fastm36 tfastm36 fastf36 tfastf36 glsearch36 ggsearch36 map_db; 	rm -rf ../bin/*
make[2]: Leaving directory '/<<PKGBUILDDIR>>/src'
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   dh_autoreconf_clean -O--sourcedirectory=src
   dh_clean -O--sourcedirectory=src
 debian/rules binary-arch
dh binary-arch --sourcedirectory src
   dh_update_autotools_config -a -O--sourcedirectory=src
   dh_autoreconf -a -O--sourcedirectory=src
   dh_auto_configure -a -O--sourcedirectory=src
   debian/rules override_dh_auto_build
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_build --sourcedirectory make --builddirectory src --buildsystem makefile -- -f "../make/Makefile.linux64"
	cd src && make -j4 "INSTALL=install --strip-program=true" -f ../make/Makefile.linux64
make[2]: Entering directory '/<<PKGBUILDDIR>>/src'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DCOMP_THR -DCOMP_MLIB -c comp_lib9.c -o comp_mthr9.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c work_thr2.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c pthr_subs2.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DCOMP_THR  -DCOMP_MLIB -c compacc2e.c -o compacc2_t.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c mshowbest.c -o showbest.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c build_ares.c -o build_ares.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c re_getlib.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DCOMP_THR -c mshowalign2.c -o mshowalign2_t.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c htime.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c apam.c
mshowalign2.c: In function 'showalign':
mshowalign2.c:614:64: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
  614 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                              ~~^
      |                                                                |
      |                                                                long unsigned int
      |                                                              %u
  615 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                         ~~~~~~~~~~~~~                           
      |                         |
      |                         size_t {aka unsigned int}
mshowalign2.c:614:68: warning: format '%lu' expects argument of type 'long unsigned int', but argument 6 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
  614 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                                  ~~^
      |                                                                    |
      |                                                                    long unsigned int
      |                                                                  %u
  615 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                                       ~~~~~~~~~~~~~                 
      |                                       |
      |                                       size_t {aka unsigned int}
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c doinit.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTA initfa.c -o init_fa.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DLOCAL_SCORE -c scaleswn.c -o scale_se.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c karlin.c
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c dropnfa.c -o drop_nfa.o
scaleswn.c: In function 'process_hist':
scaleswn.c:255:55: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
  255 |       fprintf(stderr," cannot allocate pstat_union: %ld\n",sizeof(struct pstat_str));
      |                                                     ~~^    ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                       |    |
      |                                                       |    unsigned int
      |                                                       long int
      |                                                     %d
dropnfa.c: In function 'init_work':
dropnfa.c:306:77: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
  306 |     fprintf (stderr,"*** error [%s:%d] - cannot allocate diagonal arrays: %lu\n",
      |                                                                           ~~^
      |                                                                             |
      |                                                                             long unsigned int
      |                                                                           %u
cc -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -Wdate-time -D_FORTIFY_SOURCE=2  -c -o wm_align.o wm_align.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTA -c cal_cons2.c -o calcons_fa.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c nmgetlib.c -o lgetlib.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c mmgetaa.c -o lgetaa_m.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c c_dispn.c
nmgetlib.c: In function 'open_lib':
nmgetlib.c:403:59: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
  403 |         fprintf(stderr,"\n *** cannot allocate lmf_str (%ld) for %s\n",
      |                                                         ~~^
      |                                                           |
      |                                                           long int
      |                                                         %d
  404 |                 sizeof(struct lmf_str),lib_p->file_name);
      |                 ~~~~~~~~~~~~~~~~~~~~~~                     
      |                 |
      |                 unsigned int
nmgetlib.c: In function 'sel_hacc_libstr_init':
nmgetlib.c:2026:49: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2026 |     fprintf(stderr, "cannot allocate acc_hash[%ld]\n",hash_max*sizeof(int));
      |                                               ~~^     ~~~~~~~~~~~~~~~~~~~~
      |                                                 |             |
      |                                                 long int      unsigned int
      |                                               %d
nmgetlib.c:2032:54: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2032 |     fprintf(stderr, "cannot allocate acc_hash_link[%ld]\n",acc_cnt*sizeof(char *));
      |                                                    ~~^     ~~~~~~~~~~~~~~~~~~~~~~
      |                                                      |            |
      |                                                      long int     unsigned int
      |                                                    %d
nmgetlib.c: In function 'sel_hacc_gi_init':
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c ncbl2_mlib.c -o ncbl2_mlib.o
nmgetlib.c:2154:48: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2154 |     fprintf(stderr, "cannot allocate gi_hash[%ld]\n",hash_max*sizeof(int));
      |                                              ~~^     ~~~~~~~~~~~~~~~~~~~~
      |                                                |             |
      |                                                long int      unsigned int
      |                                              %d
nmgetlib.c:2160:53: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2160 |     fprintf(stderr, "cannot allocate gi_hash_link[%ld]\n",acc_cnt*sizeof(char *));
      |                                                   ~~^     ~~~~~~~~~~~~~~~~~~~~~~
      |                                                     |            |
      |                                                     long int     unsigned int
      |                                                   %d
nmgetlib.c: In function 'agetlib':
nmgetlib.c:621:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  621 |         fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:623:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  623 |         fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:667:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  667 |     fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:682:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  682 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'aranlib':
nmgetlib.c:702:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  702 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'qgetlib':
nmgetlib.c:766:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  766 |         fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:768:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  768 |         fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:800:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  800 |     fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'qranlib':
nmgetlib.c:823:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  823 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'lgetlib':
nmgetlib.c:878:7: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  878 |       fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |       ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:916:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  916 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'lget_ann':
nmgetlib.c:940:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  940 |   fgets(desc,sizeof(desc),lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:942:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  942 |     fgets(desc,sizeof(desc),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:946:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  946 |   fgets(acc,sizeof(acc),lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:948:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  948 |     fgets(acc,sizeof(acc),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:956:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  956 |   fgets(ver,sizeof(ver),lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:958:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  958 |     fgets(ver,sizeof(ver),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'lranlib':
nmgetlib.c:1032:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1032 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1039:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1039 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'pgetlib':
nmgetlib.c:1078:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1078 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf); /* get the extra line */
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1100:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1100 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'pranlib':
nmgetlib.c:1124:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1124 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1128:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1128 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1130:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1130 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1136:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1136 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'egetlib':
nmgetlib.c:1220:1: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1220 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'eranlib':
nmgetlib.c:1250:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1250 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1255:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1255 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1258:56: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1258 |   while (lm_fd->lline[0]!='D' || lm_fd->lline[1]!='E') fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |                                                        ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1265:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1265 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'igetlib':
nmgetlib.c:1297:46: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1297 |                 while (lm_fd->lline[0]==';') fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |                                              ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1329:13: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1329 |             fgets(lm_fd->lline,MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
      |             ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1333:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1333 |         fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'iranlib':
nmgetlib.c:1360:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1360 |         fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1371:38: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1371 |         while (lm_fd->lline[0]==';') fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |                                      ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1380:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1380 |         fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'vgetlib':
nmgetlib.c:1419:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1419 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1459:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1459 |     fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1465:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1465 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'vranlib':
nmgetlib.c:1492:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1492 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1508:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1508 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1525:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1525 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'gcg_getlib':
nmgetlib.c:1567:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1567 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1570:9: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1570 |         fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf);
      |         ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1572:7: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1572 |       fgets(&lm_fd->lline[strlen(lm_fd->lline)-MAX_STR/2],MAX_STR/2,lm_fd->libf);
      |       ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1592:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
 1592 |   fread((char *)seqp,(size_t)r_block,(size_t)1,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1607:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1607 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c: In function 'gcg_ranlib':
nmgetlib.c:1631:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1631 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1641:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1641 |     fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
nmgetlib.c:1672:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
 1672 |   fgets(lm_fd->lline,MAX_STR,lm_fd->libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c lib_sel.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c url_subs.c
ncbl2_mlib.c: In function 'ncbl2_getlibn':
ncbl2_mlib.c:1433:61: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
 1433 |                 " could not read sequence record: %s %lld %ld != %ld: %d\n",
      |                                                           ~~^
      |                                                             |
      |                                                             long int
      |                                                           %d
 1434 |                 libstr,*libpos,tmp,seqcnt,*seq);
      |                                ~~~                           
      |                                |
      |                                size_t {aka unsigned int}
ncbl2_mlib.c:1453:65: warning: format '%ld' expects argument of type 'long int', but argument 4 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
 1453 |         fprintf(stderr," could not read sequence record: %lld %ld/%ld\n",
      |                                                               ~~^
      |                                                                 |
      |                                                                 long int
      |                                                               %d
 1454 |                 *libpos,tmp,seqcnt);
      |                         ~~~                                      
      |                         |
      |                         size_t {aka unsigned int}
ncbl2_mlib.c:1593:72: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'unsigned int' [-Wformat=]
 1593 |       fprintf(stderr, "*** error [%s:%d] malloc amb table error size %ld\n",
      |                                                                      ~~^
      |                                                                        |
      |                                                                        long int
      |                                                                      %d
 1594 |               __FILE__, __LINE__, amb_cnt * sizeof(unsigned int));
      |                                   ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~        
      |                                           |
      |                                           unsigned int
ncbl2_mlib.c: In function 'load_ncbl2':
ncbl2_mlib.c:810:5: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
  810 |     fread(title_str,(size_t)1,(size_t)title_len,ifile);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:820:7: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
  820 |       fread(pdb_title_str,(size_t)1,(size_t)pdb_title_len,ifile);
      |       ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:831:5: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
  831 |     fread(date_str,(size_t)1,(size_t)date_len,ifile);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'ncbl2_ranlib':
ncbl2_mlib.c:1719:5: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
 1719 |     fread(str,(size_t)1,(size_t)(llen),m_fd->hfile);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c:1734:5: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
 1734 |     fread(my_buff,(size_t)1,llen,m_fd->hfile);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_int4_read':
ncbl2_mlib.c:1840:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
 1840 |   fread((char *)&b[0],(size_t)1,(size_t)4,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_long4_read':
ncbl2_mlib.c:1855:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
 1855 |   fread((char *)&b[0],(size_t)1,(size_t)4,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_uint4_read':
ncbl2_mlib.c:1868:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
 1868 |   fread((char *)&b[0],(size_t)1,(size_t)4,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_long8_read':
ncbl2_mlib.c:1883:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
 1883 |   fread((char *)&b[0],(size_t)1,(size_t)8,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'ncbi_long8_read':
ncbl2_mlib.c:1903:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
 1903 |   fread((char *)&b[0],(size_t)1,(size_t)8,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_char_read':
ncbl2_mlib.c:1910:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
 1910 |   fread(val,(size_t)1,(size_t)1,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
ncbl2_mlib.c: In function 'src_fstr_read':
ncbl2_mlib.c:1915:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
 1915 |   fread(val,(size_t)slen,(size_t)1,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -Wdate-time -D_FORTIFY_SOURCE=2  -c -o mrandom.o mrandom.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DSW_SSE2 -DSSEARCH initfa.c -o init_sw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o dropgsw2_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSW_SSE2 -c smith_waterman_sse2.c
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c wm_align.c -o lwm_align.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSSEARCH -c cal_cons2.c -o calcons_sw.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c pssm_asn_subs.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DCOMP_MLIB -c comp_lib9.c -o comp_mlib9.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DCOMP_MLIB -c compacc2e.c -o compacc2_s.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DLALIGN -c mshowalign2.c -o lshowalign.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DLALIGN initfa.c -o init_lal.o
mshowalign2.c: In function 'showalign':
mshowalign2.c:614:64: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
  614 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                              ~~^
      |                                                                |
      |                                                                long unsigned int
      |                                                              %u
  615 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                         ~~~~~~~~~~~~~                           
      |                         |
      |                         size_t {aka unsigned int}
mshowalign2.c:614:68: warning: format '%lu' expects argument of type 'long unsigned int', but argument 6 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
  614 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                                  ~~^
      |                                                                    |
      |                                                                    long unsigned int
      |                                                                  %u
  615 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                                       ~~~~~~~~~~~~~                 
      |                                       |
      |                                       size_t {aka unsigned int}
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c last_thresh.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o droplal2_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c lsim4.c
lsim4.c: In function 'ckalloc':
lsim4.c:994:47: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
  994 |     fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
      |                                             ~~^            ~~~~~~
      |                                               |            |
      |                                               long int     size_t {aka unsigned int}
      |                                             %d
lsim4.c:994:51: warning: format '%ld' expects argument of type 'long int', but argument 4 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
  994 |     fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
      |                                                 ~~^               ~~~~
      |                                                   |               |
      |                                                   long int        size_t {aka unsigned int}
      |                                                 %d
lsim4.c:994:55: warning: format '%ld' expects argument of type 'long int', but argument 5 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
  994 |     fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal);
      |                                                     ~~^                ~~~~~~
      |                                                       |                |
      |                                                       long int         size_t {aka unsigned int}
      |                                                     %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -DLCAL_CONS -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c cal_cons2.c -o calcons_la.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTS initfa.c -o init_fs.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c scaleswt.c -o scaleswts.o
initfa.c: In function 'alloc_pam2p':
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c last_tat.c
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
scaleswt.c: In function 'process_hist':
scaleswt.c:184:52: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
  184 |       fprintf(stderr," cannot allocate rs_snion: %ld\n",sizeof(struct pstat_str));
      |                                                  ~~^    ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                    |    |
      |                                                    |    unsigned int
      |                                                    long int
      |                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTS tatstats.c -o tatstats_fs.o
scaleswt.c: In function 'last_stats':
scaleswt.c:1230:48: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 1230 |       fprintf(stderr," cannot allocate rs_s: %ld\n",sizeof(struct pstat_str));
      |                                              ~~^    ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                |    |
      |                                                |    unsigned int
      |                                                long int
      |                                              %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTS -c dropfs2.c -o drop_fs2.o
dropfs2.c: In function 'init_work':
dropfs2.c:377:61: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
  377 |        fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
      |                                                           ~~^
      |                                                             |
      |                                                             long int
      |                                                           %d
  378 |                 tat_size * sizeof(struct tat_str *));
      |                 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~          
      |                          |
      |                          unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTS -c cal_consf.c -o calcons_fs.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTX initfa.c -o init_fx.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c faatran.c
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c dropfx2.c -o drop_fx.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTX -DTFAST initfa.c -o init_tfx.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DTFAST dropfx2.c -o drop_tfx.o
dropfx2.c: In function 'do_walign':
dropfx2.c:2660:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
 2660 |     fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 2661 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
dropfx2.c: In function 'do_walign':
dropfx2.c:2660:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
 2660 |     fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 2661 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTY initfa.c -o init_fy.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c dropfz3.c -o drop_fz.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTY -DTFAST initfa.c -o init_tfy.o
dropfz3.c: In function 'init_work':
dropfz3.c:629:79: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
  629 |       fprintf (stderr,"*** error [%s:%d] - cannot allocate diagonal arrays: %lu\n",
      |                                                                             ~~^
      |                                                                               |
      |                                                                               long unsigned int
      |                                                                             %u
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DTFAST dropfz3.c -o drop_tfz.o
dropfz3.c: In function 'do_walign':
dropfz3.c:2672:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
 2672 |     fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 2673 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
dropfz3.c: In function 'init_work':
dropfz3.c:629:79: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
  629 |       fprintf (stderr,"*** error [%s:%d] - cannot allocate diagonal arrays: %lu\n",
      |                                                                             ~~^
      |                                                                               |
      |                                                                               long unsigned int
      |                                                                             %u
dropfz3.c: In function 'do_walign':
dropfz3.c:2672:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
 2672 |     fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 2673 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTS -DTFAST  initfa.c -o init_tfs.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DTFAST -DFASTS dropfs2.c -o drop_tfs.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DTFAST -DFASTS -c cal_consf.c -o calcons_tfs.o
dropfs2.c: In function 'init_work':
dropfs2.c:377:61: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
  377 |        fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
      |                                                           ~~^
      |                                                             |
      |                                                             long int
      |                                                           %d
  378 |                 tat_size * sizeof(struct tat_str *));
      |                 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~          
      |                          |
      |                          unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTM initfa.c -o init_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTM tatstats.c -o tatstats_fm.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTM dropfs2.c -o drop_fm.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTM -c cal_consf.c -o calcons_fm.o
dropfs2.c: In function 'init_work':
dropfs2.c:377:61: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
  377 |        fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
      |                                                           ~~^
      |                                                             |
      |                                                             long int
      |                                                           %d
  378 |                 tat_size * sizeof(struct tat_str *));
      |                 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~          
      |                          |
      |                          unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c mshowalign2.c -o mshowalign2_s.o
mshowalign2.c: In function 'showalign':
mshowalign2.c:614:64: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
  614 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                              ~~^
      |                                                                |
      |                                                                long unsigned int
      |                                                              %u
  615 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                         ~~~~~~~~~~~~~                           
      |                         |
      |                         size_t {aka unsigned int}
mshowalign2.c:614:68: warning: format '%lu' expects argument of type 'long unsigned int', but argument 6 has type 'size_t' {aka 'unsigned int'} [-Wformat=]
  614 |         fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n",
      |                                                                  ~~^
      |                                                                    |
      |                                                                    long unsigned int
      |                                                                  %u
  615 |                 nc,maxc,strlen(seqc0),strlen(seqc1));
      |                                       ~~~~~~~~~~~~~                 
      |                                       |
      |                                       size_t {aka unsigned int}
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTM -DTFAST  initfa.c -o init_tfm.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DTFAST -DFASTM dropfs2.c -o drop_tfm.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DTFAST -DFASTM -c cal_consf.c -o calcons_tfm.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTF initfa.c -o init_ff.o
dropfs2.c: In function 'init_work':
dropfs2.c:377:61: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
  377 |        fprintf (stderr, " cannot allocate tatprobs array: %ld\n",
      |                                                           ~~^
      |                                                             |
      |                                                             long int
      |                                                           %d
  378 |                 tat_size * sizeof(struct tat_str *));
      |                 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~          
      |                          |
      |                          unsigned int
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTF -c scaleswt.c -o scaleswtf.o
scaleswt.c: In function 'process_hist':
scaleswt.c:184:52: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
  184 |       fprintf(stderr," cannot allocate rs_snion: %ld\n",sizeof(struct pstat_str));
      |                                                  ~~^    ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                    |    |
      |                                                    |    unsigned int
      |                                                    long int
      |                                                  %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTF tatstats.c -o tatstats_ff.o
scaleswt.c: In function 'last_stats':
scaleswt.c:1230:48: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 1230 |       fprintf(stderr," cannot allocate rs_s: %ld\n",sizeof(struct pstat_str));
      |                                              ~~^    ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                |    |
      |                                                |    unsigned int
      |                                                long int
      |                                              %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTF  dropff2.c -o drop_ff2.o
dropff2.c: In function 'init_work':
dropff2.c:120:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
  120 |      fprintf(stderr, "*** error [%s:%d] - cannot calloc f_str [%lu]\n",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
  121 |              __FILE__, __LINE__, sizeof(struct f_struct));
      |                                  ~~~~~~~~~~~~~~~~~~~~~~~          
      |                                  |
      |                                  unsigned int
dropff2.c: In function 'do_walign':
dropff2.c:1176:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
 1176 |     fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 1177 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DFASTF -c cal_consf.c -o calcons_ff.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTF -DTFAST initfa.c -o init_tf.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DFASTF -DTFAST dropff2.c -o drop_tff.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DTFAST -DFASTF -c cal_consf.c -o calcons_tff.o
dropff2.c: In function 'init_work':
dropff2.c:120:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
  120 |      fprintf(stderr, "*** error [%s:%d] - cannot calloc f_str [%lu]\n",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
  121 |              __FILE__, __LINE__, sizeof(struct f_struct));
      |                                  ~~~~~~~~~~~~~~~~~~~~~~~          
      |                                  |
      |                                  unsigned int
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DNORMAL_DIST -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c scaleswn.c -o scale_sn.o
dropff2.c: In function 'do_walign':
dropff2.c:1176:66: warning: format '%lu' expects argument of type 'long unsigned int', but argument 5 has type 'unsigned int' [-Wformat=]
 1176 |     fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]",
      |                                                                ~~^
      |                                                                  |
      |                                                                  long unsigned int
      |                                                                %u
 1177 |             __FILE__, __LINE__, sizeof(struct a_res_str));
      |                                 ~~~~~~~~~~~~~~~~~~~~~~~~          
      |                                 |
      |                                 unsigned int
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
scaleswn.c: In function 'process_hist':
scaleswn.c:255:55: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
  255 |       fprintf(stderr," cannot allocate pstat_union: %ld\n",sizeof(struct pstat_str));
      |                                                     ~~^    ~~~~~~~~~~~~~~~~~~~~~~~~
      |                                                       |    |
      |                                                       |    unsigned int
      |                                                       long int
      |                                                     %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DSW_SSE2 -DGLSEARCH initfa.c -o init_lnw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DSW_SSE2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c dropnnw2.c -o droplnw_sse.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSW_SSE2 -c glocal_sse2.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DGGSEARCH -c wm_align.c -o gwm_align.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c -DSW_SSE2 -DGGSEARCH initfa.c -o init_gnw_sse.o
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DGLOBAL_GLOBAL -DSW_SSE2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -c dropnnw2.c -o dropgnw_sse.o
initfa.c: In function 'alloc_pam2p':
initfa.c:2001:46: warning: format '%ld' expects argument of type 'long int', but argument 3 has type 'unsigned int' [-Wformat=]
 2001 |               "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int));
      |                                            ~~^     ~~~~~~~~~~~~~~~~~~~~~~~
      |                                              |                |
      |                                              long int         unsigned int
      |                                            %d
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -DSW_SSE2 -c global_sse2.c
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit  -DM10_CONS  -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP  -D_LARGEFILE64_SOURCE  -DBIG_LIB64 -o ../bin/map_db map_db.c
map_db.c: In function 'main':
map_db.c:149:5: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  149 |     fgets(lname,sizeof(lname),stdin);
      |     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
map_db.c: In function 'gbf_get_ent':
map_db.c:512:3: warning: ignoring return value of 'fgets' declared with attribute 'warn_unused_result' [-Wunused-result]
  512 |   fgets(lline,MAXLINE,libf);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~
map_db.c: In function 'src_int4_read':
map_db.c:524:3: warning: ignoring return value of 'fread' declared with attribute 'warn_unused_result' [-Wunused-result]
  524 |   fread((char *)&b[0],(size_t)1,(size_t)4,fd);
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fasta36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fa.o drop_nfa.o wm_align.o calcons_fa.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm   -lpthread
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/ssearch36 comp_mthr9.o	 work_thr2.o  pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_sw_sse.o dropgsw2_sse.o smith_waterman_sse2.o lwm_align.o calcons_sw.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/lalign36 comp_mlib9.o	 compacc2_s.o showbest.o build_ares.o re_getlib.o lshowalign.o htime.o apam.o doinit.o init_lal.o droplal2_sse.o smith_waterman_sse2.o lsim4.o calcons_la.o scale_se.o karlin.o last_thresh.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm  
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fasts36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fs.o drop_fs2.o calcons_fs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
initfa.c: In function 'get_lambda.constprop':
initfa.c:2224:24: warning: argument 1 value '2294967297' exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2224 |   if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) {
      |                        ^
/usr/include/stdlib.h:542:14: note: in a call to allocation function 'calloc' declared here
  542 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
initfa.c: In function 'get_lambda.constprop':
initfa.c:2224:24: warning: argument 1 value '2294967297' exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2224 |   if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) {
      |                        ^
/usr/include/stdlib.h:542:14: note: in a call to allocation function 'calloc' declared here
  542 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
/usr/bin/ld: /tmp/cckc3JCq.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fastx36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fx.o drop_fx.o faatran.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/cc0PF49J.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfastx36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfx.o drop_tfx.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/ccI7YQMA.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fasty36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fy.o drop_fz.o faatran.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/ccn7raOS.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfasty36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfy.o drop_tfz.o scale_se.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/ccLIHIXQ.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfasts36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfs.o drop_tfs.o calcons_tfs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/cc1P1vQq.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fastm36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fm.o drop_fm.o calcons_fm.o scaleswts.o last_tat.o tatstats_fm.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/cc0SnJX1.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfastm36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_s.o htime.o apam.o doinit.o init_tfm.o drop_tfm.o calcons_tfm.o scaleswts.o tatstats_fm.o last_tat.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowalign2.c:85:1: warning: type of 'buf_align_seq' does not match original declaration [-Wlto-type-mismatch]
   85 | buf_align_seq(unsigned char **aa0, int n0,
      | ^
compacc2e.c:3575:1: note: type mismatch in parameter 8
 3575 | buf_align_seq(unsigned char **aa0, int n0,
      | ^
compacc2e.c:3575:1: note: 'buf_align_seq' was previously declared here
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/cco8SUCK.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fastf36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_ff.o drop_ff2.o calcons_ff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/ccnl7saJ.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfastf36 comp_mthr9.o	 work_thr2.o pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tf.o drop_tff.o calcons_tff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:236:1: warning: type of 'process_hist' does not match original declaration [-Wlto-type-mismatch]
  236 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: type mismatch in parameter 7
  164 | process_hist(struct stat_str *sptr, int nstats,
      | ^
scaleswt.c:164:1: note: 'process_hist' was previously declared here
scaleswt.c:164:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/cc55kNIb.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/glsearch36 comp_mthr9.o	 work_thr2.o  pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_lnw_sse.o droplnw_sse.o glocal_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/ccQzV65t.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
/usr/bin/ld: /tmp/cc5Y8MRN.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
cc -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/ggsearch36 comp_mthr9.o	 work_thr2.o  pthr_subs2.o compacc2_t.o   showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_gnw_sse.o dropgnw_sse.o global_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o  lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm   -lpthread
compacc2e.c:954:1: warning: type of 're_openlib' does not match original declaration [-Wlto-type-mismatch]
  954 | re_openlib(struct lmf_str *, int outtty);
      | ^
nmgetlib.c:503:3: note: type mismatch in parameter 2
  503 |   re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty)
      |   ^
nmgetlib.c:503:3: note: 're_openlib' was previously declared here
nmgetlib.c:503:3: note: code may be misoptimized unless '-fno-strict-aliasing' is used
mshowbest.c:63:1: warning: type of 's_annot_to_aa1a' does not match original declaration [-Wlto-type-mismatch]
   63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr);
      | ^
compacc2e.c:2290:1: note: type mismatch in parameter 2
 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) {
      | ^
compacc2e.c:2290:1: note: 's_annot_to_aa1a' was previously declared here
compacc2e.c:2290:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:250:5: warning: type of 'last_calc' does not match original declaration [-Wlto-type-mismatch]
  250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn,
      |     ^
initfa.c:2036:1: note: type mismatch in parameter 6
 2036 | last_calc(
      | ^
initfa.c:2036:1: note: 'last_calc' was previously declared here
mshowbest.c:82:1: warning: type of 'get_annot' does not match original declaration [-Wlto-type-mismatch]
   82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: type mismatch in parameter 5
 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p,
      | ^
compacc2e.c:2178:1: note: 'get_annot' was previously declared here
compacc2e.c:2178:1: note: code may be misoptimized unless '-fno-strict-aliasing' is used
comp_lib9.c:287:1: warning: type of 'showalign' does not match original declaration [-Wlto-type-mismatch]
  287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn,
      | ^
mshowalign2.c:134:6: note: 'showalign' was previously declared here
  134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn,
      |      ^
mshowalign2.c:134:6: note: code may be misoptimized unless '-fno-strict-aliasing' is used
/usr/bin/ld: /tmp/ccH2ZoA3.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
initfa.c: In function 'get_lambda.constprop':
initfa.c:2224:24: warning: argument 1 value '2294967297' exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2224 |   if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) {
      |                        ^
/usr/include/stdlib.h:542:14: note: in a call to allocation function 'calloc' declared here
  542 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
initfa.c: In function 'get_lambda.constprop':
initfa.c:2224:24: warning: argument 1 value '2294967297' exceeds maximum object size 2147483647 [-Walloc-size-larger-than=]
 2224 |   if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) {
      |                        ^
/usr/include/stdlib.h:542:14: note: in a call to allocation function 'calloc' declared here
  542 | extern void *calloc (size_t __nmemb, size_t __size)
      |              ^
/usr/bin/ld: /tmp/ccw3NM8U.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
/usr/bin/ld: /tmp/ccqGW7HV.ltrans0.ltrans.o: in function `main':
/<<PKGBUILDDIR>>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp'
make[2]: Leaving directory '/<<PKGBUILDDIR>>/src'
# convoluted, but necessary to allow cross builds
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   debian/rules override_dh_auto_test
make[1]: Entering directory '/<<PKGBUILDDIR>>'
cd test ; ./test2G.sh && ./test.sh && ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg

STARTING FASTA36 Sun Jun 12 23:01:17 UTC 2022 on testbuildd
Linux testbuildd 4.9.0-0.bpo.6-armmp #1 SMP Debian 4.9.82-1+deb9u3~bpo8+1 (2018-03-22) armv7l GNU/Linux

starting prss36(ssearch/fastx) Sun Jun 12 23:01:17 UTC 2022
done
starting lalign36 Sun Jun 12 23:01:19 UTC 2022
FINISHED Sun Jun 12 23:14:18 UTC 2022

STARTING FASTA36 Sun Jun 12 23:14:18 UTC 2022 on testbuildd
Linux testbuildd 4.9.0-0.bpo.6-armmp #1 SMP Debian 4.9.82-1+deb9u3~bpo8+1 (2018-03-22) armv7l GNU/Linux

starting prss36(ssearch/fastx) Sun Jun 12 23:14:18 UTC 2022
done
starting lalign36 Sun Jun 12 23:14:20 UTC 2022
FINISHED Sun Jun 12 23:27:20 UTC 2022
# ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg
FASTA searches a protein or DNA sequence data bank
 version 36.3.8h Aug, 2019
Please cite:
 W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: ../seq/mgstm1.aa
  1>>>sp|P10649|GSTM1_MOUSE Glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; Glutathione S-transferase GT8.7; pmGT10 - 218 aa
Library: ../seq/prot_test.lseg
     2267 residues in    12 sequences

Statistics: (shuffled [473]) MLE statistics: Lambda= 0.1869;  K=0.009911
 statistics sampled from 4 (4) to 472 sequences
Algorithm: FASTA (3.8 Nov 2011) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.667), E-opt: 0.2 (0.333), width:  16
 Scan time:  0.050

The best scores are:                                      opt bits E(12)
sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu ( 218) 1242 343.6   2e-98
sp|P00502|GSTA1_RAT Glutathione S-transferase alph ( 222)  237 72.6   8e-17
sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Ho ( 142)   51 22.5   0.064
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinas ( 351)   43 20.3    0.69
sp|P14960|RBS_GUITH Ribulose bisphosphate carboxyl ( 139)   36 18.4       1
sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG ( 108)   31 17.1     1.9
sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodyte ( 105)   30 16.8     2.2
sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A  ( 567)   37 18.7     3.1
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle  ( 160)   30 16.8     3.2
sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A (  95)   26 15.7     3.8
sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococc (  54)   22 14.6     4.4
sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Ho ( 106)   23 14.9     6.3

>>sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 O  (218 aa)
 initn: 1242 init1: 1242 opt: 1242  Z-score: 1818.7  bits: 343.6 E(12): 2e-98
Smith-Waterman score: 1242; 78.0% identity (95.4% similar) in 218 aa overlap (1-218:1-218)

               10        20        30        40        50        60
sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL
       ::::::::..:::.: ::.:::::::::.::.::::::::.:::::::::::::::::::
sp|P09 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
               10        20        30        40        50        60

               70        80        90       100       110       120
sp|P10 PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF
       ::::::.:::::::::: :.::::.: ::::::.::.::.:::.::..::: :.::::.:
sp|P09 PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
               70        80        90       100       110       120

              130       140       150       160       170       180
sp|P10 EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN
       :: ::..:. .:::.:::::::::::::::.:.:.::::.::.:: .:.:::::::::::
sp|P09 EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
              130       140       150       160       170       180

              190       200       210        
sp|P10 LRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
       :.::..:::::.::::::::::..  :.::::: :.::
sp|P09 LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
              190       200       210        

>>sp|P00502|GSTA1_RAT Glutathione S-transferase alpha-1   (222 aa)
 initn: 204 init1:  73 opt: 237  Z-score: 353.9  bits: 72.6 E(12): 8e-17
Smith-Waterman score: 237; 27.4% identity (57.0% similar) in 223 aa overlap (4-218:6-218)

                 10        20        30        40        50        
sp|P10   MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKL--GLD
            .: :.:.::  . :: ::  .   .:::         : .:    ::.:   .: 
sp|P00 MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEK---------FIQSPEDLEKLKKDGNLM
               10        20        30                 40        50 

         60         70        80        90       100        110    
sp|P10 FPNLPYL-IDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMD-TRMQLIML
       : ..:.. :::  :..:. ::: :.: :. : :.  .::   :.  . ..: :.: . ..
sp|P00 FDQVPMVEIDG-MKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLV
              60         70        80        90       100       110

          120         130       140         150       160       170
sp|P10 CYNPDFEKQKPEFLK--TIPEKMKLYSEFLGK--RPWFAGDKVTYVDFLAYDILDQYRMF
          :: .. :  . :  :  . .  . . : .  . ...:...: ::.   ..:   . :
sp|P00 ICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEF
              120       130       140       150       160       170

              180       190       200       210            
sp|P10 EPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK    
       . . : .:: :. : .:. .: ... ... .     :. .:. . . :    
sp|P00 DASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
              180       190       200       210       220  

>>sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo s  (142 aa)
 initn:  40 init1:  40 opt:  51  Z-score: 86.3  bits: 22.5 E(12): 0.064
Smith-Waterman score: 51; 25.6% identity (69.2% similar) in 39 aa overlap (177-214:36-73)

        150       160       170       180       190       200      
sp|P10 WFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS-SRYIA
                                     .::. . .. .:. :.. :: .:. .. .:
sp|P69 ADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFD-LSHGSAQVKGHGKKVA
          10        20        30        40         50        60    

         210                                                       
sp|P10 TPIFSKMAHWSNK                                               
         . . .::                                                   
sp|P69 DALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHA
           70        80        90       100       110       120    

>>sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase ca  (351 aa)
 initn:  43 init1:  43 opt:  43  Z-score: 67.5  bits: 20.3 E(12): 0.69
Smith-Waterman score: 54; 23.6% identity (47.2% similar) in 72 aa overlap (137-206:229-300)

        110       120       130       140       150       160      
sp|P10 TRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQ
                                     .:    :  :.:: . .   . ..   .  
sp|P00 LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRF
      200       210       220       230       240       250        

        170       180         190       200       210              
sp|P10 YRMFEPKCLDAFPNLR--DFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK      
          :     : . ::   :.  :: .::.    .:. ...::                  
sp|P00 PSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPK
      260       270       280       290       300       310        

sp|P00 FKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
      320       330       340       350 

>>sp|P14960|RBS_GUITH Ribulose bisphosphate carboxylase   (139 aa)
 initn:  56 init1:  36 opt:  36  Z-score: 64.6  bits: 18.4 E(12):    1
Smith-Waterman score: 36; 57.1% identity (85.7% similar) in 7 aa overlap (7-13:47-53)

                                       10        20        30      
sp|P10                         MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMG
                                     ::.. ::                       
sp|P14 EQIVKQIQYAISKNWALNVEWTDDPHPRNAYWDLWGLPLFGIKDPAAVMFEINACRKAKP
         20        30        40        50        60        70      

         40        50        60        70        80        90      
sp|P10 DAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIR
                                                                   
sp|P14 ACYVKVNAFDNSRGVESCCLSFIVQRPTSNEPGFQLIRSEVDSRNIRYTIQSYASTRPEG
         80        90       100       110       120       130      

>>sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=  (108 aa)
 initn:  31 init1:  31 opt:  31  Z-score: 59.2  bits: 17.1 E(12):  1.9
Smith-Waterman score: 33; 36.0% identity (54.0% similar) in 50 aa overlap (150-190:16-64)

     120       130       140       150       160          170      
sp|P10 FEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDI---LDQYRMFE---PK
                                     ::.:: .   . ::   :. :..     ::
sp|P01                DIQMTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPK
                              10        20        30        40     

             180        190       200       210                    
sp|P10 CL--DAFPNLRDFL-ARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK            
        :  ::  ::.  . .:: :                                        
sp|P01 ILIYDA-SNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKL
          50         60        70        80        90       100    

>>sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodytes GN  (105 aa)
 initn:  30 init1:  30 opt:  30  Z-score: 58.0  bits: 16.8 E(12):  2.2
Smith-Waterman score: 36; 26.5% identity (54.4% similar) in 68 aa overlap (129-193:28-88)

      100       110       120       130       140          150     
sp|P10 IVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWF---AGDKVTY
                                     :: :.   :...  :. : .   :..:   
sp|P99    MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKG
                  10        20        30        40        50       

         160       170       180       190       200       210     
sp|P10 VDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHW
       . . . : : .: . .::    .:. . .   : :.::                      
sp|P99 I-IWGEDTLMEY-LENPK--KYIPGTKMI---FVGIKKKEERADLIAYLKKATNE     
         60         70          80           90       100          

          
sp|P10 SNK

>>sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A viru  (567 aa)
 initn:  37 init1:  37 opt:  37  Z-score: 55.1  bits: 18.7 E(12):  3.1
Smith-Waterman score: 50; 28.2% identity (64.1% similar) in 39 aa overlap (74-111:399-437)

            50        60        70        80         90       100  
sp|P10 SQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARK-HHLDGETEEERIRADIVEN
                                     : ...   .: :... :  : . : . .:.
sp|P03 GFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEK
      370       380       390       400       410       420        

            110       120       130       140       150       160  
sp|P10 QVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYD
        : ::...:                                                   
sp|P03 YVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYH
      430       440       450       460       470       480        

>>sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=H  (160 aa)
 initn:  30 init1:  30 opt:  30  Z-score: 54.7  bits: 16.8 E(12):  3.2
Smith-Waterman score: 41; 25.9% identity (63.0% similar) in 54 aa overlap (44-92:13-62)

            20        30        40        50        60        70   
sp|P10 THPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--
                                     :. .  .:: ..:.    .  ::.  :.  
sp|P02                   MTDQQAEARSYLSEEMIAEFKAAFDM----FDADGGGDISVK
                                 10        20            30        

              80           90       100       110       120        
sp|P10 QSNAILRYLAR---KHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFL
       . ....:.:..   :..::.  ::                                    
sp|P02 ELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAE
       40        50        60        70        80        90        

>>sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A31 O  (95 aa)
 initn:  26 init1:  26 opt:  26  Z-score: 53.0  bits: 15.7 E(12):  3.8
Smith-Waterman score: 30; 54.5% identity (63.6% similar) in 11 aa overlap (115-125:86-94)

           90       100       110       120       130       140    
sp|P10 HLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGK
                                     : ::   ::.:                   
sp|P60 SRGKVVELGCAATCPSKKPYEEVTCCSTDKC-NPH-PKQRPG                  
          60        70        80          90                       

          150       160       170       180       190       200    
sp|P10 RPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYI

>>sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococcus a  (54 aa)
 initn:  22 init1:  22 opt:  22  Z-score: 51.5  bits: 14.6 E(12):  4.4
Smith-Waterman score: 25; 50.0% identity (100.0% similar) in 4 aa overlap (171-174:15-18)

              150       160       170       180       190       200
sp|P10 FLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS
                                     .:.:                          
sp|P00                 AYVINDSCIACGACKPECPVNIQQGSIYAIDADSCIDCGSCASV
                               10        20        30        40    

              210        
sp|P10 SRYIATPIFSKMAHWSNK
                         
sp|P00 CPVGAPNPED        
           50            

>>sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Homo s  (106 aa)
 initn:  23 init1:  23 opt:  23  Z-score: 47.7  bits: 14.9 E(12):  6.3
Smith-Waterman score: 35; 18.3% identity (53.5% similar) in 71 aa overlap (58-124:12-82)

        30        40        50        60        70          80     
sp|P10 YDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--QSNAILRYLARKHH
                                     :.   : .:. ...   .:   :    . .
sp|P01                    TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK
                                  10        20        30        40 

          90       100       110         120       130       140   
sp|P10 LDGETEEERIRADIVENQVMDTRMQL--IMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLG
       .:.  .    . ...:..  :. ..:   .   . :.::.:                   
sp|P01 VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
              50        60        70        80        90       100 

           150       160       170       180       190       200   
sp|P10 KRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRY
                                                                   
sp|P01 NRGEC                                                       
                                                                   



218 residues in 1 query   sequences
2267 residues in 12 library sequences
 Tcomplib [36.3.8h Aug, 2019] (4 proc in memory [0G])
 start: Sun Jun 12 23:27:20 2022 done: Sun Jun 12 23:27:20 2022
 Total Scan time:  0.050 Total Display time:  0.040

Function used was FASTA [36.3.8h Aug, 2019]
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   create-stamp debian/debhelper-build-stamp
   dh_testroot -a -O--sourcedirectory=src
   dh_prep -a -O--sourcedirectory=src
   dh_auto_install -a -O--sourcedirectory=src
   dh_install -a -O--sourcedirectory=src
   dh_installdocs -a -O--sourcedirectory=src
   dh_installchangelogs -a -O--sourcedirectory=src
   dh_installexamples -a -O--sourcedirectory=src
   dh_installman -a -O--sourcedirectory=src
   dh_installsystemduser -a -O--sourcedirectory=src
   dh_perl -a -O--sourcedirectory=src
   dh_link -a -O--sourcedirectory=src
   dh_strip_nondeterminism -a -O--sourcedirectory=src
   debian/rules override_dh_compress
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_compress --exclude=.pdf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   dh_fixperms -a -O--sourcedirectory=src
   dh_missing -a -O--sourcedirectory=src
   dh_dwz -a -O--sourcedirectory=src
   dh_strip -a -O--sourcedirectory=src
   dh_makeshlibs -a -O--sourcedirectory=src
   dh_shlibdeps -a -O--sourcedirectory=src
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/fasta3/usr/bin/tfastf36 debian/fasta3/usr/bin/ssearch36 debian/fasta3/usr/bin/ggsearch36 debian/fasta3/usr/bin/fasta36 debian/fasta3/usr/bin/map_db debian/fasta3/usr/bin/tfasty36 debian/fasta3/usr/bin/tfasts36 debian/fasta3/usr/bin/tfastx36 debian/fasta3/usr/bin/tfastm36 debian/fasta3/usr/bin/fastx36 debian/fasta3/usr/bin/lalign36 debian/fasta3/usr/bin/glsearch36 debian/fasta3/usr/bin/fasts36 debian/fasta3/usr/bin/fastf36 debian/fasta3/usr/bin/fastm36 debian/fasta3/usr/bin/fasty36 were not linked against ld-linux-armhf.so.3 (they use none of the library's symbols)
   dh_installdeb -a -O--sourcedirectory=src
   dh_gencontrol -a -O--sourcedirectory=src
   dh_md5sums -a -O--sourcedirectory=src
   dh_builddeb -a -O--sourcedirectory=src
dpkg-deb: building package 'fasta3' in '../fasta3_36.3.8h.2020-02-11-4+b6_armhf.deb'.
dpkg-deb: building package 'fasta3-dbgsym' in '../fasta3-dbgsym_36.3.8h.2020-02-11-4+b6_armhf.deb'.
 dpkg-genbuildinfo --build=any -O../fasta3_36.3.8h.2020-02-11-4+b6_armhf.buildinfo
 dpkg-genchanges --build=any -mRaspbian wandboard test autobuilder <root@raspbian.org> -O../fasta3_36.3.8h.2020-02-11-4+b6_armhf.changes
dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included)
 dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
--------------------------------------------------------------------------------
Build finished at 2022-06-12T23:28:30Z

Finished
--------

I: Built successfully

+------------------------------------------------------------------------------+
| Post Build Chroot                                                            |
+------------------------------------------------------------------------------+


+------------------------------------------------------------------------------+
| Changes                                                                      |
+------------------------------------------------------------------------------+


fasta3_36.3.8h.2020-02-11-4+b6_armhf.changes:
---------------------------------------------

Format: 1.8
Date: Thu, 09 Sep 2021 09:29:56 +0200
Source: fasta3 (36.3.8h.2020-02-11-4)
Binary: fasta3 fasta3-dbgsym
Binary-Only: yes
Architecture: armhf
Version: 36.3.8h.2020-02-11-4+b6
Distribution: bookworm-staging
Urgency: low
Maintainer: Raspbian wandboard test autobuilder <root@raspbian.org>
Changed-By: Raspbian wandboard test autobuilder <root@raspbian.org>
Description:
 fasta3     - tools for searching collections of biological sequences
Changes:
 fasta3 (36.3.8h.2020-02-11-4+b6) bookworm-staging; urgency=low, binary-only=yes
 .
   * Binary-only non-maintainer upload for armhf; no source changes.
   * rebuild due to debcheck failure
Checksums-Sha1:
 bae370bdb31c05ebec3dc3d48a2922fb47be665c 5152656 fasta3-dbgsym_36.3.8h.2020-02-11-4+b6_armhf.deb
 efd5e327d54d1d470fb7d8ec9c82774f8e7c7853 5385 fasta3_36.3.8h.2020-02-11-4+b6_armhf.buildinfo
 7a179b492c19036886437f0036c35f39c839ab86 720904 fasta3_36.3.8h.2020-02-11-4+b6_armhf.deb
Checksums-Sha256:
 779e9178f58b2c29c5f666ba4aa862a93f4273245aac4c99cb00a3909399b56e 5152656 fasta3-dbgsym_36.3.8h.2020-02-11-4+b6_armhf.deb
 a8c3c45204c240d357f9b046fe9d7717aa7a8acfb212ba893c4bd545600d7f91 5385 fasta3_36.3.8h.2020-02-11-4+b6_armhf.buildinfo
 904d692bc8043620b0648fedf8b30a5fef326e2750b1b75b7f92cbe5fd25a3d9 720904 fasta3_36.3.8h.2020-02-11-4+b6_armhf.deb
Files:
 a383129619a3b6f02af84c79e0d5ef81 5152656 debug optional fasta3-dbgsym_36.3.8h.2020-02-11-4+b6_armhf.deb
 bb22716e0f05cf5f337fe021c43795f0 5385 science optional fasta3_36.3.8h.2020-02-11-4+b6_armhf.buildinfo
 4ee0202bb80c13e83153bd4b8cae685d 720904 science optional fasta3_36.3.8h.2020-02-11-4+b6_armhf.deb

+------------------------------------------------------------------------------+
| Package contents                                                             |
+------------------------------------------------------------------------------+


fasta3-dbgsym_36.3.8h.2020-02-11-4+b6_armhf.deb
-----------------------------------------------

 new Debian package, version 2.0.
 size 5152656 bytes: control archive=1336 bytes.
    1037 bytes,    12 lines      control              
    1782 bytes,    17 lines      md5sums              
 Package: fasta3-dbgsym
 Source: fasta3 (36.3.8h.2020-02-11-4)
 Version: 36.3.8h.2020-02-11-4+b6
 Auto-Built-Package: debug-symbols
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 5691
 Depends: fasta3 (= 36.3.8h.2020-02-11-4+b6)
 Section: debug
 Priority: optional
 Description: debug symbols for fasta3
 Build-Ids: 048e34da36deeaa31b866c6596517b6d068a8d6b 183fd773e0b8308da5f4ccb272e24f32b11c7a1a 1b8577d1eb173fcefe9c0f4e2824232e8808cfdb 355cef30634b2d3c212490f3273c162904488b64 3e3283f669e40f6ea7bc639ccb7415ebc22b6b80 46bdebd2f6e9e6585967cd661a55bbc64cd68270 608400e5da92df6b8718f4e3981c072e6635f8a9 8a019e1f329510218a0e30779cac1fa5c795a142 92b1ae8b2f7d0dfe704fe1f494e6b8dee15ab861 bc8a4406604c085e7e84151b957a057c544c5349 bcd46424a882882556b0325e4ef04a7f41620894 c1516139de05fbc198f14d5174f3246dd52636e8 cc212411754075646b3861a970ca68a2a93ce5d3 f1cfbab8524634df208c56887ead2070a3517941 fa06fc9fe0b21b5894c0db09860515ece6de28dd fa545a74e9c1136ad8cf10043f8d471c00f020fe

drwxr-xr-x root/root         0 2021-09-09 07:29 ./
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/04/
-rw-r--r-- root/root    389520 2021-09-09 07:29 ./usr/lib/debug/.build-id/04/8e34da36deeaa31b866c6596517b6d068a8d6b.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/18/
-rw-r--r-- root/root    418604 2021-09-09 07:29 ./usr/lib/debug/.build-id/18/3fd773e0b8308da5f4ccb272e24f32b11c7a1a.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/1b/
-rw-r--r-- root/root    335884 2021-09-09 07:29 ./usr/lib/debug/.build-id/1b/8577d1eb173fcefe9c0f4e2824232e8808cfdb.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/35/
-rw-r--r-- root/root    420104 2021-09-09 07:29 ./usr/lib/debug/.build-id/35/5cef30634b2d3c212490f3273c162904488b64.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/3e/
-rw-r--r-- root/root    338576 2021-09-09 07:29 ./usr/lib/debug/.build-id/3e/3283f669e40f6ea7bc639ccb7415ebc22b6b80.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/46/
-rw-r--r-- root/root    436152 2021-09-09 07:29 ./usr/lib/debug/.build-id/46/bdebd2f6e9e6585967cd661a55bbc64cd68270.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/60/
-rw-r--r-- root/root    342444 2021-09-09 07:29 ./usr/lib/debug/.build-id/60/8400e5da92df6b8718f4e3981c072e6635f8a9.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/8a/
-rw-r--r-- root/root    438252 2021-09-09 07:29 ./usr/lib/debug/.build-id/8a/019e1f329510218a0e30779cac1fa5c795a142.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/92/
-rw-r--r-- root/root    338832 2021-09-09 07:29 ./usr/lib/debug/.build-id/92/b1ae8b2f7d0dfe704fe1f494e6b8dee15ab861.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/bc/
-rw-r--r-- root/root    342188 2021-09-09 07:29 ./usr/lib/debug/.build-id/bc/8a4406604c085e7e84151b957a057c544c5349.debug
-rw-r--r-- root/root    383472 2021-09-09 07:29 ./usr/lib/debug/.build-id/bc/d46424a882882556b0325e4ef04a7f41620894.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/c1/
-rw-r--r-- root/root    391704 2021-09-09 07:29 ./usr/lib/debug/.build-id/c1/516139de05fbc198f14d5174f3246dd52636e8.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/cc/
-rw-r--r-- root/root    386540 2021-09-09 07:29 ./usr/lib/debug/.build-id/cc/212411754075646b3861a970ca68a2a93ce5d3.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/f1/
-rw-r--r-- root/root    395684 2021-09-09 07:29 ./usr/lib/debug/.build-id/f1/cfbab8524634df208c56887ead2070a3517941.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.build-id/fa/
-rw-r--r-- root/root     15628 2021-09-09 07:29 ./usr/lib/debug/.build-id/fa/06fc9fe0b21b5894c0db09860515ece6de28dd.debug
-rw-r--r-- root/root    339712 2021-09-09 07:29 ./usr/lib/debug/.build-id/fa/545a74e9c1136ad8cf10043f8d471c00f020fe.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.dwz/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/lib/debug/.dwz/arm-linux-gnueabihf/
-rw-r--r-- root/root     80464 2021-09-09 07:29 ./usr/lib/debug/.dwz/arm-linux-gnueabihf/fasta3.debug
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/doc/
lrwxrwxrwx root/root         0 2021-09-09 07:29 ./usr/share/doc/fasta3-dbgsym -> fasta3


fasta3_36.3.8h.2020-02-11-4+b6_armhf.deb
----------------------------------------

 new Debian package, version 2.0.
 size 720904 bytes: control archive=5824 bytes.
    2193 bytes,    54 lines      control              
   13616 bytes,   184 lines      md5sums              
 Package: fasta3
 Source: fasta3 (36.3.8h.2020-02-11-4)
 Version: 36.3.8h.2020-02-11-4+b6
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 5562
 Depends: libc6 (>= 2.33), python3
 Suggests: perl:any, libdbi-perl, libwww-perl, libjson-perl, libhtml-tableextract-perl, libxml-twig-perl, liburi-encode-perl, libdbd-mysql-perl, python3-mysqldb, ncbi-blast+, bedtools
 Section: science
 Priority: optional
 Homepage: https://fasta.bioch.virginia.edu
 Description: tools for searching collections of biological sequences
  The FASTA programs find regions of local or global similarity between
  Protein or DNA sequences, either by searching Protein or DNA databases,
  or by identifying local duplications within a sequence. Other
  programs provide information on the statistical significance of an
  alignment. Like BLAST, FASTA can be used to infer functional and
  evolutionary relationships between sequences as well as help identify
  members of gene families.
  .
   * Protein
     - Protein-protein FASTA
     - Protein-protein Smith-Waterman (ssearch)
     - Global Protein-protein (Needleman-Wunsch) (ggsearch)
     - Global/Local protein-protein (glsearch)
     - Protein-protein with unordered peptides (fasts)
     - Protein-protein with mixed peptide sequences (fastf)
  .
   * Nucleotide
     - Nucleotide-Nucleotide (DNA/RNA fasta)
     - Ordered Nucleotides vs Nucleotide (fastm)
     - Un-ordered Nucleotides vs Nucleotide (fasts)
  .
   * Translated
     - Translated DNA (with frameshifts, e.g. ESTs)
       vs Proteins (fastx/fasty)
     - Protein vs Translated DNA (with frameshifts)
       (tfastx/tfasty)
     - Peptides vs Translated DNA (tfasts)
  .
   * Statistical Significance
     - Protein vs Protein shuffle (prss)
     - DNA vs DNA shuffle (prss)
     - Translated DNA vs Protein shuffle (prfx)
  .
   * Local Duplications
     - Local Protein alignments (lalign)
     - Plot Protein alignment "dot-plot" (plalign)
     - Local DNA alignments (lalign)
     - Plot DNA alignment "dot-plot" (plalign)
  .
  This software is often used via a web service at the
  EBI with readily indexed reference databases at
  http://www.ebi.ac.uk/Tools/fasta/.

drwxr-xr-x root/root         0 2021-09-09 07:29 ./
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/bin/
-rwxr-xr-x root/root    313224 2021-09-09 07:29 ./usr/bin/fasta36
-rwxr-xr-x root/root    266652 2021-09-09 07:29 ./usr/bin/fastf36
-rwxr-xr-x root/root    266588 2021-09-09 07:29 ./usr/bin/fastm36
-rwxr-xr-x root/root    266588 2021-09-09 07:29 ./usr/bin/fasts36
-rwxr-xr-x root/root    305112 2021-09-09 07:29 ./usr/bin/fastx36
-rwxr-xr-x root/root    313304 2021-09-09 07:29 ./usr/bin/fasty36
-rwxr-xr-x root/root    366304 2021-09-09 07:29 ./usr/bin/ggsearch36
-rwxr-xr-x root/root    366304 2021-09-09 07:29 ./usr/bin/glsearch36
-rwxr-xr-x root/root    337696 2021-09-09 07:29 ./usr/bin/lalign36
-rwxr-xr-x root/root      9816 2021-09-09 07:29 ./usr/bin/map_db
-rwxr-xr-x root/root    341856 2021-09-09 07:29 ./usr/bin/ssearch36
-rwxr-xr-x root/root    271020 2021-09-09 07:29 ./usr/bin/tfastf36
-rwxr-xr-x root/root    270956 2021-09-09 07:29 ./usr/bin/tfastm36
-rwxr-xr-x root/root    270956 2021-09-09 07:29 ./usr/bin/tfasts36
-rwxr-xr-x root/root    309200 2021-09-09 07:29 ./usr/bin/tfastx36
-rwxr-xr-x root/root    313296 2021-09-09 07:29 ./usr/bin/tfasty36
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/doc/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/doc/fasta3/
-rw-r--r-- root/root       233 2021-09-09 07:29 ./usr/share/doc/fasta3/changelog.Debian.armhf.gz
-rw-r--r-- root/root      1274 2021-09-09 07:29 ./usr/share/doc/fasta3/changelog.Debian.gz
-rw-r--r-- root/root      2874 2021-09-09 07:29 ./usr/share/doc/fasta3/copyright
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/doc/fasta3/examples/
drwxr-xr-x root/root         0 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/
-rw-r--r-- root/root      2528 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/bovgh.seq
-rw-r--r-- root/root       986 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/bovprl.seq
-rw-r--r-- root/root      3159 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/dna_test_s.nlib
-rw-r--r-- root/root       261 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/dyr_human.aa
-rw-r--r-- root/root      1286 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/egmsmg.aa
-rw-r--r-- root/root       806 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/grou_drome.pseg
-rw-r--r-- root/root     18633 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gst.nlib
-rw-r--r-- root/root      1405 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gst.seq
-rw-r--r-- root/root       309 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstm1_human.vaa
-rw-r--r-- root/root      1226 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstm1b_human.nt
-rw-r--r-- root/root      1226 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstm1b_human_fs.nt
-rw-r--r-- root/root       314 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstt1_drome.aa
-rw-r--r-- root/root       311 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gtm1_human.aa
-rw-r--r-- root/root       291 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gtt1_drome.aa
-rw-r--r-- root/root       247 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/h10_human.aa
-rw-r--r-- root/root       225 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/hahu.aa
-rw-r--r-- root/root      7118 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.gcg
-rw-r--r-- root/root      2788 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.seq
-rw-r--r-- root/root      1323 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/humgstd.seq
-rw-r--r-- root/root       271 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/lcbo.aa
-rw-r--r-- root/root        56 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/m1r.aa
-rw-r--r-- root/root        50 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/m2.aa
-rw-r--r-- root/root       189 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mchu.aa
-rw-r--r-- root/root      3440 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.3nt
-rw-r--r-- root/root       342 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.aa
-rw-r--r-- root/root       310 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.aaa
-rw-r--r-- root/root      1220 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.e05
-rw-r--r-- root/root      1122 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.eeq
-rw-r--r-- root/root      1116 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.esq
-rw-r--r-- root/root       406 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.gcg
-rw-r--r-- root/root       282 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.lc
-rw-r--r-- root/root       677 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt
-rw-r--r-- root/root       682 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1
-rw-r--r-- root/root      1352 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt12r
-rw-r--r-- root/root      2033 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13
-rw-r--r-- root/root      2028 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13r
-rw-r--r-- root/root       681 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1r
-rw-r--r-- root/root       160 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nts
-rw-r--r-- root/root       259 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.raa
-rw-r--r-- root/root      1167 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.rev
-rw-r--r-- root/root      1158 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.seq
-rw-r--r-- root/root    148692 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1_genclone.seq
-rw-r--r-- root/root      1286 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgtt2_x.seq
-rw-r--r-- root/root        43 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ms1.aa
-rw-r--r-- root/root      2361 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mu.lib
-rw-r--r-- root/root       275 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/musplfm.aa
-rw-r--r-- root/root      2047 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mwkw.aa
-rw-r--r-- root/root       500 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mwrtc1.aa
-rw-r--r-- root/root      1294 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/myosin_bp.aa
-rw-r--r-- root/root        27 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n0.aa
-rw-r--r-- root/root        47 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n1.aa
-rw-r--r-- root/root       692 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2.aa
-rw-r--r-- root/root      1482 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2_fs.lib
-rw-r--r-- root/root       178 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2s.aa
-rw-r--r-- root/root       243 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2t.aa
-rw-r--r-- root/root       330 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n_fs.lib
-rw-r--r-- root/root       217 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ngt.aa
-rw-r--r-- root/root       111 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ngts.aa
-rw-r--r-- root/root       385 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/oohu.aa
-rw-r--r-- root/root       401 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/oohu.raa
-rw-r--r-- root/root       340 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prio_atepa.aa
-rw-r--r-- root/root      2741 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prot_test.lib
-rw-r--r-- root/root      3391 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prot_test.lseg
-rw-r--r-- root/root      1530 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prot_test_s.lseg
-rw-r--r-- root/root       914 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/qrhuld.aa
-rw-r--r-- root/root     34874 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/titin_hum.aa
-rw-r--r-- root/root     83286 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/titin_hum.seq
-rw-r--r-- root/root       302 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/xurt8c.aa
-rw-r--r-- root/root       302 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/xurt8c.lc
-rw-r--r-- root/root       281 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/xurtg.aa
drwxr-xr-x root/root         0 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/
-rw-r--r-- root/root       992 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/README
-rw-r--r-- root/root       536 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/create_seq_demo.sql
-rwxr-xr-x root/root      3227 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/join_up50.pl
-rw-r--r-- root/root       347 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/mysql_demo1.sql
-rw-r--r-- root/root       388 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/mysql_demo_pv.sql
-rwxr-xr-x root/root      3300 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/nr_to_sql.pl
-rw-r--r-- root/root       230 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/pirpsd.sql
-rw-r--r-- root/root       317 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/psql_demo.sql
-rw-r--r-- root/root       373 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/psql_demo1.sql
-rw-r--r-- root/root       343 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/psql_demo_pv.sql
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/fasta3/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/fasta3/data/
-rw-r--r-- root/root      2764 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_10.mat
-rw-r--r-- root/root      2548 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_120.mat
-rw-r--r-- root/root      2548 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_160.mat
-rw-r--r-- root/root      2546 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_20.mat
-rw-r--r-- root/root      2548 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_200.mat
-rw-r--r-- root/root      2546 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_40.mat
-rw-r--r-- root/root      2545 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_80.mat
-rw-r--r-- root/root      1922 2020-02-10 19:14 ./usr/share/fasta3/data/blosum45.mat
-rw-r--r-- root/root      1921 2020-02-10 19:14 ./usr/share/fasta3/data/blosum50.mat
-rw-r--r-- root/root      1922 2020-02-10 19:14 ./usr/share/fasta3/data/blosum62.mat
-rw-r--r-- root/root      1924 2020-02-10 19:14 ./usr/share/fasta3/data/blosum80.mat
-rw-r--r-- root/root       976 2020-02-10 19:14 ./usr/share/fasta3/data/dna.mat
-rw-r--r-- root/root      2256 2020-02-10 19:14 ./usr/share/fasta3/data/idn_aa.mat
-rw-r--r-- root/root      2255 2020-02-10 19:14 ./usr/share/fasta3/data/md_10.mat
-rw-r--r-- root/root      2256 2020-02-10 19:14 ./usr/share/fasta3/data/md_20.mat
-rw-r--r-- root/root      2255 2020-02-10 19:14 ./usr/share/fasta3/data/md_40.mat
-rw-r--r-- root/root      1922 2020-02-10 19:14 ./usr/share/fasta3/data/pam120.mat
-rw-r--r-- root/root      1923 2020-02-10 19:14 ./usr/share/fasta3/data/pam250.mat
-rw-r--r-- root/root       998 2020-02-10 19:14 ./usr/share/fasta3/data/rna.mat
-rw-r--r-- root/root      2771 2020-02-10 19:14 ./usr/share/fasta3/data/vtml160.mat
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/fasta3/misc/
-rw-r--r-- root/root       424 2020-02-10 19:14 ./usr/share/fasta3/misc/README
-rwxr-xr-x root/root      3447 2020-02-10 19:14 ./usr/share/fasta3/misc/parse_m9.pl
-rwxr-xr-x root/root       367 2020-02-10 19:14 ./usr/share/fasta3/misc/res2R.pl
-rwxr-xr-x root/root      3177 2020-02-10 19:14 ./usr/share/fasta3/misc/shuffle_embed.pl
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/fasta3/scripts/
-rw-r--r-- root/root      5789 2020-02-10 19:14 ./usr/share/fasta3/scripts/README
-rw-r--r-- root/root      3182 2020-02-10 19:14 ./usr/share/fasta3/scripts/README.scripts
-rw-r--r-- root/root        76 2020-02-10 19:14 ./usr/share/fasta3/scripts/acc_examples
-rwxr-xr-x root/root     12507 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_all.pl
-rwxr-xr-x root/root      7198 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_ens.pl
-rwxr-xr-x root/root      4691 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_ncbi.pl
-rwxr-xr-x root/root      8501 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_up_sql.pl
-rwxr-xr-x root/root     12193 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_up_sql_www.pl
-rwxr-xr-x root/root      9074 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_up_www.pl
-rwxr-xr-x root/root     15898 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats2ipr.pl
-rwxr-xr-x root/root     15966 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats2ipr_e.pl
-rwxr-xr-x root/root     13489 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats_up_sql.pl
-rwxr-xr-x root/root     12705 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats_up_www2.pl
-rwxr-xr-x root/root     14506 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_ipr_www.pl
-rwxr-xr-x root/root      9490 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pdb_cath.pl
-rwxr-xr-x root/root      8375 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pdb_vast.pl
-rwxr-xr-x root/root     27672 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pfam30_tmptbl.pl
-rwxr-xr-x root/root     27255 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pfam_sql.pl
-rwxr-xr-x root/root     20385 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pfam_www.pl
-rw-r--r-- root/root       321 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_script_list
-rwxr-xr-x root/root     23627 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl
-rwxr-xr-x root/root     44866 2021-09-09 07:29 ./usr/share/fasta3/scripts/annot_blast_btop2.pl
-rwxr-xr-x root/root     25321 2021-09-09 07:29 ./usr/share/fasta3/scripts/annot_blast_btop3.py
-rwxr-xr-x root/root     26399 2021-09-09 07:29 ./usr/share/fasta3/scripts/annot_blast_btop4.py
-rwxr-xr-x root/root      1779 2021-09-09 07:29 ./usr/share/fasta3/scripts/blastp_annot_cmd.sh
-rwxr-xr-x root/root       753 2021-09-09 07:29 ./usr/share/fasta3/scripts/blastp_cmd.sh
-rwxr-xr-x root/root      4583 2020-02-10 19:14 ./usr/share/fasta3/scripts/color_defs.pl
-rwxr-xr-x root/root      4564 2021-09-09 07:29 ./usr/share/fasta3/scripts/exp_up_ensg.pl
-rwxr-xr-x root/root      3275 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_links.pl
-rwxr-xr-x root/root      5572 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_refseq_isoforms.pl
-rwxr-xr-x root/root      2576 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_uniref50.pl
-rwxr-xr-x root/root      6043 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_up_isoforms.pl
-rwxr-xr-x root/root      1590 2021-09-09 07:29 ./usr/share/fasta3/scripts/fasta_annot_cmd.sh
-rwxr-xr-x root/root      1676 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_genome_seq.py
-rwxr-xr-x root/root      2234 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_protein.py
-rwxr-xr-x root/root      1497 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_protein_sql.py
-rwxr-xr-x root/root      4000 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_protein_sql_www.py
-rwxr-xr-x root/root       878 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_refseq.py
-rwxr-xr-x root/root       441 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_uniprot.py
-rwxr-xr-x root/root      1188 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_up_prot_iso_sql.py
-rwxr-xr-x root/root      8976 2021-09-09 07:29 ./usr/share/fasta3/scripts/lav2plt.pl
-rwxr-xr-x root/root     14885 2021-09-09 07:29 ./usr/share/fasta3/scripts/lavplt_ps.pl
-rwxr-xr-x root/root     13069 2021-09-09 07:29 ./usr/share/fasta3/scripts/lavplt_svg.pl
-rwxr-xr-x root/root      1909 2021-09-09 07:29 ./usr/share/fasta3/scripts/links2sql.pl
-rwxr-xr-x root/root     11092 2021-09-09 07:29 ./usr/share/fasta3/scripts/m8_btop_msa.pl
-rwxr-xr-x root/root     18926 2021-09-09 07:29 ./usr/share/fasta3/scripts/m9B_btop_msa.pl
-rwxr-xr-x root/root     16976 2021-09-09 07:29 ./usr/share/fasta3/scripts/map_exon_coords.py
-rwxr-xr-x root/root      7659 2021-09-09 07:29 ./usr/share/fasta3/scripts/merge_blast_btab.pl
-rwxr-xr-x root/root      9415 2021-09-09 07:29 ./usr/share/fasta3/scripts/merge_fasta_btab.pl
-rwxr-xr-x root/root     19093 2020-02-10 19:14 ./usr/share/fasta3/scripts/plot_domain2t.cgi
-rwxr-xr-x root/root      5135 2021-09-09 07:29 ./usr/share/fasta3/scripts/relabel_domains.py
-rwxr-xr-x root/root     30354 2021-09-09 07:29 ./usr/share/fasta3/scripts/rename_exons.py
-rwxr-xr-x root/root      3042 2021-09-09 07:29 ./usr/share/fasta3/scripts/summ_domain_ident.pl
-rwxr-xr-x root/root       706 2021-09-09 07:29 ./usr/share/fasta3/scripts/test_ann_scripts.sh
-rwxr-xr-x root/root      2978 2021-09-09 07:29 ./usr/share/fasta3/scripts/test_py.sh
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/man/
drwxr-xr-x root/root         0 2021-09-09 07:29 ./usr/share/man/man1/
-rw-r--r-- root/root      7358 2021-09-09 07:29 ./usr/share/man/man1/fasta36.1.gz
-rw-r--r-- root/root      2195 2021-09-09 07:29 ./usr/share/man/man1/fastf3.1.gz
-rw-r--r-- root/root      2119 2021-09-09 07:29 ./usr/share/man/man1/fasts3.1.gz
-rw-r--r-- root/root       523 2021-09-09 07:29 ./usr/share/man/man1/map_db.1.gz
-rw-r--r-- root/root      2146 2021-09-09 07:29 ./usr/share/man/man1/prss3.1.gz
-rw-r--r-- root/root       402 2021-09-09 07:29 ./usr/share/man/man1/ps_lav.1.gz


+------------------------------------------------------------------------------+
| Post Build                                                                   |
+------------------------------------------------------------------------------+


+------------------------------------------------------------------------------+
| Cleanup                                                                      |
+------------------------------------------------------------------------------+

Purging /<<BUILDDIR>>
Not cleaning session: cloned chroot in use

+------------------------------------------------------------------------------+
| Summary                                                                      |
+------------------------------------------------------------------------------+

Build Architecture: armhf
Build-Space: 52980
Build-Time: 2271
Distribution: bookworm-staging
Host Architecture: armhf
Install-Time: 270
Job: fasta3_36.3.8h.2020-02-11-4
Machine Architecture: armhf
Package: fasta3
Package-Time: 2593
Source-Version: 36.3.8h.2020-02-11-4
Space: 52980
Status: successful
Version: 36.3.8h.2020-02-11-4+b6
--------------------------------------------------------------------------------
Finished at 2022-06-12T23:28:30Z
Build needed 00:43:13, 52980k disc space