libedlib →
1.2.4-2+b2 →
armhf → 2020-12-09 10:46:18
sbuild (Debian sbuild) 0.72.0 (25 Oct 2016) on mb-lxc-01
+==============================================================================+
| libedlib 1.2.4-2+b2 (armhf) Wed, 09 Dec 2020 10:40:48 +0000 |
+==============================================================================+
Package: libedlib
Version: 1.2.4-2+b2
Source Version: 1.2.4-2
Distribution: bullseye-staging
Machine Architecture: armhf
Host Architecture: armhf
Build Architecture: armhf
I: NOTICE: Log filtering will replace 'var/lib/schroot/mount/bullseye-staging-armhf-sbuild-12185115-f27a-45f3-918c-e5d3709454c8' with '<<CHROOT>>'
+------------------------------------------------------------------------------+
| Update chroot |
+------------------------------------------------------------------------------+
Get:1 http://172.17.0.1/private bullseye-staging InRelease [11.3 kB]
Get:2 http://172.17.0.1/private bullseye-staging/main Sources [11.9 MB]
Get:3 http://172.17.0.1/private bullseye-staging/main armhf Packages [12.9 MB]
Fetched 24.9 MB in 9s (2744 kB/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
+------------------------------------------------------------------------------+
| Fetch source files |
+------------------------------------------------------------------------------+
Check APT
---------
Checking available source versions...
Download source files with APT
------------------------------
Reading package lists...
NOTICE: 'libedlib' packaging is maintained in the 'Git' version control system at:
https://salsa.debian.org/med-team/libedlib.git
Please use:
git clone https://salsa.debian.org/med-team/libedlib.git
to retrieve the latest (possibly unreleased) updates to the package.
Need to get 4316 kB of source archives.
Get:1 http://172.17.0.1/private bullseye-staging/main libedlib 1.2.4-2 (dsc) [2221 B]
Get:2 http://172.17.0.1/private bullseye-staging/main libedlib 1.2.4-2 (tar) [4308 kB]
Get:3 http://172.17.0.1/private bullseye-staging/main libedlib 1.2.4-2 (diff) [5872 B]
Fetched 4316 kB in 1s (5110 kB/s)
Download complete and in download only mode
I: NOTICE: Log filtering will replace 'build/libedlib-74ukbY/libedlib-1.2.4' with '<<PKGBUILDDIR>>'
I: NOTICE: Log filtering will replace 'build/libedlib-74ukbY' with '<<BUILDDIR>>'
+------------------------------------------------------------------------------+
| Install build-essential |
+------------------------------------------------------------------------------+
Setup apt archive
-----------------
Merged Build-Depends: build-essential, fakeroot
Filtered Build-Depends: build-essential, fakeroot
dpkg-deb: building package 'sbuild-build-depends-core-dummy' in '/<<BUILDDIR>>/resolver-ox1c0L/apt_archive/sbuild-build-depends-core-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning: sbuild-build-depends-core-dummy
dpkg-scanpackages: info: Wrote 1 entries to output Packages file.
gpg: keybox '/<<BUILDDIR>>/resolver-ox1c0L/gpg/pubring.kbx' created
gpg: /<<BUILDDIR>>/resolver-ox1c0L/gpg/trustdb.gpg: trustdb created
gpg: key 37145E60F90AF620: public key "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" imported
gpg: Total number processed: 1
gpg: imported: 1
gpg: key 37145E60F90AF620: "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" not changed
gpg: key 37145E60F90AF620: secret key imported
gpg: Total number processed: 1
gpg: unchanged: 1
gpg: secret keys read: 1
gpg: secret keys imported: 1
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ Release [957 B]
Get:3 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ Sources [349 B]
Get:5 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ Packages [434 B]
Fetched 2110 B in 0s (8599 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...
Install core build dependencies (apt-based resolver)
----------------------------------------------------
Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
bsdextrautils libpam-cap netbase sensible-utils
Use 'apt autoremove' to remove them.
The following NEW packages will be installed:
sbuild-build-depends-core-dummy
0 upgraded, 1 newly installed, 0 to remove and 59 not upgraded.
Need to get 852 B of archives.
After this operation, 0 B of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ sbuild-build-depends-core-dummy 0.invalid.0 [852 B]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 852 B in 0s (63.9 kB/s)
Selecting previously unselected package sbuild-build-depends-core-dummy.
(Reading database ... 12594 files and directories currently installed.)
Preparing to unpack .../sbuild-build-depends-core-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-core-dummy (0.invalid.0) ...
Setting up sbuild-build-depends-core-dummy (0.invalid.0) ...
W: No sandbox user '_apt' on the system, can not drop privileges
+------------------------------------------------------------------------------+
| Check architectures |
+------------------------------------------------------------------------------+
Arch check ok (armhf included in any)
+------------------------------------------------------------------------------+
| Install package build dependencies |
+------------------------------------------------------------------------------+
Setup apt archive
-----------------
Merged Build-Depends: debhelper-compat (= 12), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools
Filtered Build-Depends: debhelper-compat (= 12), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools
dpkg-deb: building package 'sbuild-build-depends-libedlib-dummy' in '/<<BUILDDIR>>/resolver-ox1c0L/apt_archive/sbuild-build-depends-libedlib-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning: sbuild-build-depends-core-dummy sbuild-build-depends-libedlib-dummy
dpkg-scanpackages: info: Wrote 2 entries to output Packages file.
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ Release [963 B]
Get:3 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ Sources [537 B]
Get:5 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ Packages [617 B]
Fetched 2487 B in 0s (10.6 kB/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...
Install libedlib build dependencies (apt-based resolver)
--------------------------------------------------------
Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
libpam-cap netbase
Use 'apt autoremove' to remove them.
The following additional packages will be installed:
autoconf automake autopoint autotools-dev cmake cmake-data cython3 d-shlibs
debhelper dh-autoreconf dh-python dh-strip-nondeterminism dwz file gettext
gettext-base groff-base intltool-debian libarchive-zip-perl libarchive13
libbrotli1 libcroco3 libcurl4 libdebhelper-perl libelf1 libexpat1
libexpat1-dev libfile-stripnondeterminism-perl libglib2.0-0 libgssapi-krb5-2
libicu67 libjsoncpp1 libk5crypto3 libkeyutils1 libkrb5-3 libkrb5support0
libmagic-mgc libmagic1 libncurses6 libncursesw6 libnghttp2-14 libnsl2
libpipeline1 libprocps8 libpsl5 libpython3-all-dev libpython3-dev
libpython3-stdlib libpython3.9 libpython3.9-dev libpython3.9-minimal
libpython3.9-stdlib librhash0 librtmp1 libsigsegv2 libssh2-1 libssl1.1
libsub-override-perl libtinfo6 libtirpc-common libtirpc3 libtool
libuchardet0 libuv1 libxml2 m4 mailcap man-db media-types mime-support
po-debconf procps python3 python3-all python3-all-dev python3-dev
python3-distutils python3-lib2to3 python3-minimal python3-pkg-resources
python3-setuptools python3.9 python3.9-dev python3.9-minimal rename
zlib1g-dev
Suggested packages:
autoconf-archive gnu-standards autoconf-doc cmake-doc ninja-build cython-doc
dh-make gettext-doc libasprintf-dev libgettextpo-dev groff lrzip krb5-doc
krb5-user libtool-doc gfortran | fortran95-compiler gcj-jdk m4-doc apparmor
less www-browser libmail-box-perl python3-doc python3-tk python3-venv
python-setuptools-doc python3.9-venv python3.9-doc binfmt-support
Recommended packages:
curl | wget | lynx ca-certificates libarchive-cpio-perl libglib2.0-data
shared-mime-info xdg-user-dirs krb5-locales libgpm2 publicsuffix libltdl-dev
libmail-sendmail-perl psmisc libio-stringy-perl libpod-parser-perl
The following NEW packages will be installed:
autoconf automake autopoint autotools-dev cmake cmake-data cython3 d-shlibs
debhelper dh-autoreconf dh-python dh-strip-nondeterminism dwz file gettext
gettext-base groff-base intltool-debian libarchive-zip-perl libarchive13
libbrotli1 libcroco3 libcurl4 libdebhelper-perl libelf1 libexpat1
libexpat1-dev libfile-stripnondeterminism-perl libglib2.0-0 libgssapi-krb5-2
libicu67 libjsoncpp1 libk5crypto3 libkeyutils1 libkrb5-3 libkrb5support0
libmagic-mgc libmagic1 libncurses6 libnghttp2-14 libnsl2 libpipeline1
libprocps8 libpsl5 libpython3-all-dev libpython3-dev libpython3-stdlib
libpython3.9 libpython3.9-dev libpython3.9-minimal libpython3.9-stdlib
librhash0 librtmp1 libsigsegv2 libssh2-1 libssl1.1 libsub-override-perl
libtirpc-common libtirpc3 libtool libuchardet0 libuv1 libxml2 m4 mailcap
man-db media-types mime-support po-debconf procps python3 python3-all
python3-all-dev python3-dev python3-distutils python3-lib2to3
python3-minimal python3-pkg-resources python3-setuptools python3.9
python3.9-dev python3.9-minimal rename sbuild-build-depends-libedlib-dummy
zlib1g-dev
The following packages will be upgraded:
libncursesw6 libtinfo6
2 upgraded, 85 newly installed, 0 to remove and 57 not upgraded.
Need to get 40.0 MB of archives.
After this operation, 156 MB of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-ox1c0L/apt_archive ./ sbuild-build-depends-libedlib-dummy 0.invalid.0 [904 B]
Get:2 http://172.17.0.1/private bullseye-staging/main armhf libuchardet0 armhf 0.0.7-1 [65.0 kB]
Get:3 http://172.17.0.1/private bullseye-staging/main armhf groff-base armhf 1.22.4-5 [783 kB]
Get:4 http://172.17.0.1/private bullseye-staging/main armhf libpipeline1 armhf 1.5.3-1 [29.9 kB]
Get:5 http://172.17.0.1/private bullseye-staging/main armhf man-db armhf 2.9.3-2 [1269 kB]
Get:6 http://172.17.0.1/private bullseye-staging/main armhf libssl1.1 armhf 1.1.1h-1 [1271 kB]
Get:7 http://172.17.0.1/private bullseye-staging/main armhf libpython3.9-minimal armhf 3.9.1~rc1-2+rpi1 [789 kB]
Get:8 http://172.17.0.1/private bullseye-staging/main armhf libexpat1 armhf 2.2.10-1 [73.3 kB]
Get:9 http://172.17.0.1/private bullseye-staging/main armhf python3.9-minimal armhf 3.9.1~rc1-2+rpi1 [1624 kB]
Get:10 http://172.17.0.1/private bullseye-staging/main armhf python3-minimal armhf 3.9.0-4 [37.8 kB]
Get:11 http://172.17.0.1/private bullseye-staging/main armhf media-types all 1.0.1 [18.2 kB]
Get:12 http://172.17.0.1/private bullseye-staging/main armhf mailcap all 3.67 [31.3 kB]
Get:13 http://172.17.0.1/private bullseye-staging/main armhf mime-support all 3.66 [10.9 kB]
Get:14 http://172.17.0.1/private bullseye-staging/main armhf libtinfo6 armhf 6.2+20201114-1 [328 kB]
Get:15 http://172.17.0.1/private bullseye-staging/main armhf libncursesw6 armhf 6.2+20201114-1 [105 kB]
Get:16 http://172.17.0.1/private bullseye-staging/main armhf libkrb5support0 armhf 1.18.3-4 [62.3 kB]
Get:17 http://172.17.0.1/private bullseye-staging/main armhf libk5crypto3 armhf 1.18.3-4 [108 kB]
Get:18 http://172.17.0.1/private bullseye-staging/main armhf libkeyutils1 armhf 1.6.1-2 [14.5 kB]
Get:19 http://172.17.0.1/private bullseye-staging/main armhf libkrb5-3 armhf 1.18.3-4 [315 kB]
Get:20 http://172.17.0.1/private bullseye-staging/main armhf libgssapi-krb5-2 armhf 1.18.3-4 [142 kB]
Get:21 http://172.17.0.1/private bullseye-staging/main armhf libtirpc-common all 1.2.6-3 [13.3 kB]
Get:22 http://172.17.0.1/private bullseye-staging/main armhf libtirpc3 armhf 1.2.6-3 [71.2 kB]
Get:23 http://172.17.0.1/private bullseye-staging/main armhf libnsl2 armhf 1.3.0-2 [33.2 kB]
Get:24 http://172.17.0.1/private bullseye-staging/main armhf libpython3.9-stdlib armhf 3.9.1~rc1-2+rpi1 [1653 kB]
Get:25 http://172.17.0.1/private bullseye-staging/main armhf python3.9 armhf 3.9.1~rc1-2+rpi1 [460 kB]
Get:26 http://172.17.0.1/private bullseye-staging/main armhf libpython3-stdlib armhf 3.9.0-4 [21.0 kB]
Get:27 http://172.17.0.1/private bullseye-staging/main armhf python3 armhf 3.9.0-4 [64.1 kB]
Get:28 http://172.17.0.1/private bullseye-staging/main armhf libncurses6 armhf 6.2+20201114-1 [79.5 kB]
Get:29 http://172.17.0.1/private bullseye-staging/main armhf libprocps8 armhf 2:3.3.16-5 [59.8 kB]
Get:30 http://172.17.0.1/private bullseye-staging/main armhf procps armhf 2:3.3.16-5 [238 kB]
Get:31 http://172.17.0.1/private bullseye-staging/main armhf libmagic-mgc armhf 1:5.38-5 [262 kB]
Get:32 http://172.17.0.1/private bullseye-staging/main armhf libmagic1 armhf 1:5.38-5 [113 kB]
Get:33 http://172.17.0.1/private bullseye-staging/main armhf file armhf 1:5.38-5 [67.0 kB]
Get:34 http://172.17.0.1/private bullseye-staging/main armhf gettext-base armhf 0.19.8.1-10 [117 kB]
Get:35 http://172.17.0.1/private bullseye-staging/main armhf libsigsegv2 armhf 2.12-2 [32.3 kB]
Get:36 http://172.17.0.1/private bullseye-staging/main armhf m4 armhf 1.4.18-4 [185 kB]
Get:37 http://172.17.0.1/private bullseye-staging/main armhf autoconf all 2.69-11.1 [341 kB]
Get:38 http://172.17.0.1/private bullseye-staging/main armhf autotools-dev all 20180224.1 [77.0 kB]
Get:39 http://172.17.0.1/private bullseye-staging/main armhf automake all 1:1.16.2-4 [801 kB]
Get:40 http://172.17.0.1/private bullseye-staging/main armhf autopoint all 0.19.8.1-10 [435 kB]
Get:41 http://172.17.0.1/private bullseye-staging/main armhf cmake-data all 3.18.4-1+rpi1 [1725 kB]
Get:42 http://172.17.0.1/private bullseye-staging/main armhf libicu67 armhf 67.1-4 [8289 kB]
Get:43 http://172.17.0.1/private bullseye-staging/main armhf libxml2 armhf 2.9.10+dfsg-6.3 [580 kB]
Get:44 http://172.17.0.1/private bullseye-staging/main armhf libarchive13 armhf 3.4.3-2 [294 kB]
Get:45 http://172.17.0.1/private bullseye-staging/main armhf libbrotli1 armhf 1.0.9-2+b1 [261 kB]
Get:46 http://172.17.0.1/private bullseye-staging/main armhf libnghttp2-14 armhf 1.42.0-1 [66.7 kB]
Get:47 http://172.17.0.1/private bullseye-staging/main armhf libpsl5 armhf 0.21.0-1.1 [54.2 kB]
Get:48 http://172.17.0.1/private bullseye-staging/main armhf librtmp1 armhf 2.4+20151223.gitfa8646d.1-2+b2 [54.2 kB]
Get:49 http://172.17.0.1/private bullseye-staging/main armhf libssh2-1 armhf 1.8.0-2.1 [126 kB]
Get:50 http://172.17.0.1/private bullseye-staging/main armhf libcurl4 armhf 7.72.0-1 [300 kB]
Get:51 http://172.17.0.1/private bullseye-staging/main armhf libjsoncpp1 armhf 1.7.4-3.1 [65.8 kB]
Get:52 http://172.17.0.1/private bullseye-staging/main armhf librhash0 armhf 1.4.0-1 [133 kB]
Get:53 http://172.17.0.1/private bullseye-staging/main armhf libuv1 armhf 1.40.0-1 [118 kB]
Get:54 http://172.17.0.1/private bullseye-staging/main armhf cmake armhf 3.18.4-1+rpi1 [3113 kB]
Get:55 http://172.17.0.1/private bullseye-staging/main armhf cython3 armhf 0.29.21-3+b1 [1234 kB]
Get:56 http://172.17.0.1/private bullseye-staging/main armhf d-shlibs all 0.95 [17.8 kB]
Get:57 http://172.17.0.1/private bullseye-staging/main armhf libtool all 2.4.6-14 [513 kB]
Get:58 http://172.17.0.1/private bullseye-staging/main armhf dh-autoreconf all 19 [16.9 kB]
Get:59 http://172.17.0.1/private bullseye-staging/main armhf libdebhelper-perl all 13.2.1 [188 kB]
Get:60 http://172.17.0.1/private bullseye-staging/main armhf libarchive-zip-perl all 1.68-1 [104 kB]
Get:61 http://172.17.0.1/private bullseye-staging/main armhf libsub-override-perl all 0.09-2 [10.2 kB]
Get:62 http://172.17.0.1/private bullseye-staging/main armhf libfile-stripnondeterminism-perl all 1.9.0-1 [25.5 kB]
Get:63 http://172.17.0.1/private bullseye-staging/main armhf dh-strip-nondeterminism all 1.9.0-1 [15.2 kB]
Get:64 http://172.17.0.1/private bullseye-staging/main armhf libelf1 armhf 0.182-1 [162 kB]
Get:65 http://172.17.0.1/private bullseye-staging/main armhf dwz armhf 0.13-5 [142 kB]
Get:66 http://172.17.0.1/private bullseye-staging/main armhf libglib2.0-0 armhf 2.66.3-2 [1178 kB]
Get:67 http://172.17.0.1/private bullseye-staging/main armhf libcroco3 armhf 0.6.13-1 [133 kB]
Get:68 http://172.17.0.1/private bullseye-staging/main armhf gettext armhf 0.19.8.1-10 [1219 kB]
Get:69 http://172.17.0.1/private bullseye-staging/main armhf intltool-debian all 0.35.0+20060710.5 [26.8 kB]
Get:70 http://172.17.0.1/private bullseye-staging/main armhf po-debconf all 1.0.21 [248 kB]
Get:71 http://172.17.0.1/private bullseye-staging/main armhf debhelper all 13.2.1 [1007 kB]
Get:72 http://172.17.0.1/private bullseye-staging/main armhf python3-lib2to3 all 3.8.6-1 [78.4 kB]
Get:73 http://172.17.0.1/private bullseye-staging/main armhf python3-distutils all 3.8.6-1 [145 kB]
Get:74 http://172.17.0.1/private bullseye-staging/main armhf dh-python all 4.20201102 [99.3 kB]
Get:75 http://172.17.0.1/private bullseye-staging/main armhf libexpat1-dev armhf 2.2.10-1 [121 kB]
Get:76 http://172.17.0.1/private bullseye-staging/main armhf libpython3.9 armhf 3.9.1~rc1-2+rpi1 [1412 kB]
Get:77 http://172.17.0.1/private bullseye-staging/main armhf libpython3.9-dev armhf 3.9.1~rc1-2+rpi1 [3057 kB]
Get:78 http://172.17.0.1/private bullseye-staging/main armhf libpython3-dev armhf 3.9.0-4 [21.2 kB]
Get:79 http://172.17.0.1/private bullseye-staging/main armhf libpython3-all-dev armhf 3.9.0-4 [1068 B]
Get:80 http://172.17.0.1/private bullseye-staging/main armhf python3-all armhf 3.9.0-4 [1056 B]
Get:81 http://172.17.0.1/private bullseye-staging/main armhf zlib1g-dev armhf 1:1.2.11.dfsg-2 [184 kB]
Get:82 http://172.17.0.1/private bullseye-staging/main armhf python3.9-dev armhf 3.9.1~rc1-2+rpi1 [501 kB]
Get:83 http://172.17.0.1/private bullseye-staging/main armhf python3-dev armhf 3.9.0-4 [1164 B]
Get:84 http://172.17.0.1/private bullseye-staging/main armhf python3-all-dev armhf 3.9.0-4 [1060 B]
Get:85 http://172.17.0.1/private bullseye-staging/main armhf python3-pkg-resources all 50.3.0-1 [187 kB]
Get:86 http://172.17.0.1/private bullseye-staging/main armhf python3-setuptools all 50.3.0-1 [511 kB]
Get:87 http://172.17.0.1/private bullseye-staging/main armhf rename all 1.13-1 [18.0 kB]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 40.0 MB in 7s (5923 kB/s)
Selecting previously unselected package libuchardet0:armhf.
(Reading database ... 12594 files and directories currently installed.)
Preparing to unpack .../0-libuchardet0_0.0.7-1_armhf.deb ...
Unpacking libuchardet0:armhf (0.0.7-1) ...
Selecting previously unselected package groff-base.
Preparing to unpack .../1-groff-base_1.22.4-5_armhf.deb ...
Unpacking groff-base (1.22.4-5) ...
Selecting previously unselected package libpipeline1:armhf.
Preparing to unpack .../2-libpipeline1_1.5.3-1_armhf.deb ...
Unpacking libpipeline1:armhf (1.5.3-1) ...
Selecting previously unselected package man-db.
Preparing to unpack .../3-man-db_2.9.3-2_armhf.deb ...
Unpacking man-db (2.9.3-2) ...
Selecting previously unselected package libssl1.1:armhf.
Preparing to unpack .../4-libssl1.1_1.1.1h-1_armhf.deb ...
Unpacking libssl1.1:armhf (1.1.1h-1) ...
Selecting previously unselected package libpython3.9-minimal:armhf.
Preparing to unpack .../5-libpython3.9-minimal_3.9.1~rc1-2+rpi1_armhf.deb ...
Unpacking libpython3.9-minimal:armhf (3.9.1~rc1-2+rpi1) ...
Selecting previously unselected package libexpat1:armhf.
Preparing to unpack .../6-libexpat1_2.2.10-1_armhf.deb ...
Unpacking libexpat1:armhf (2.2.10-1) ...
Selecting previously unselected package python3.9-minimal.
Preparing to unpack .../7-python3.9-minimal_3.9.1~rc1-2+rpi1_armhf.deb ...
Unpacking python3.9-minimal (3.9.1~rc1-2+rpi1) ...
Setting up libssl1.1:armhf (1.1.1h-1) ...
Setting up libpython3.9-minimal:armhf (3.9.1~rc1-2+rpi1) ...
Setting up libexpat1:armhf (2.2.10-1) ...
Setting up python3.9-minimal (3.9.1~rc1-2+rpi1) ...
Selecting previously unselected package python3-minimal.
(Reading database ... 13424 files and directories currently installed.)
Preparing to unpack .../python3-minimal_3.9.0-4_armhf.deb ...
Unpacking python3-minimal (3.9.0-4) ...
Selecting previously unselected package media-types.
Preparing to unpack .../media-types_1.0.1_all.deb ...
Unpacking media-types (1.0.1) ...
Selecting previously unselected package mailcap.
Preparing to unpack .../archives/mailcap_3.67_all.deb ...
Unpacking mailcap (3.67) ...
Selecting previously unselected package mime-support.
Preparing to unpack .../mime-support_3.66_all.deb ...
Unpacking mime-support (3.66) ...
Preparing to unpack .../libtinfo6_6.2+20201114-1_armhf.deb ...
Unpacking libtinfo6:armhf (6.2+20201114-1) over (6.2+20200918-1) ...
Setting up libtinfo6:armhf (6.2+20201114-1) ...
(Reading database ... 13476 files and directories currently installed.)
Preparing to unpack .../libncursesw6_6.2+20201114-1_armhf.deb ...
Unpacking libncursesw6:armhf (6.2+20201114-1) over (6.2+20200918-1) ...
Setting up libncursesw6:armhf (6.2+20201114-1) ...
Selecting previously unselected package libkrb5support0:armhf.
(Reading database ... 13476 files and directories currently installed.)
Preparing to unpack .../00-libkrb5support0_1.18.3-4_armhf.deb ...
Unpacking libkrb5support0:armhf (1.18.3-4) ...
Selecting previously unselected package libk5crypto3:armhf.
Preparing to unpack .../01-libk5crypto3_1.18.3-4_armhf.deb ...
Unpacking libk5crypto3:armhf (1.18.3-4) ...
Selecting previously unselected package libkeyutils1:armhf.
Preparing to unpack .../02-libkeyutils1_1.6.1-2_armhf.deb ...
Unpacking libkeyutils1:armhf (1.6.1-2) ...
Selecting previously unselected package libkrb5-3:armhf.
Preparing to unpack .../03-libkrb5-3_1.18.3-4_armhf.deb ...
Unpacking libkrb5-3:armhf (1.18.3-4) ...
Selecting previously unselected package libgssapi-krb5-2:armhf.
Preparing to unpack .../04-libgssapi-krb5-2_1.18.3-4_armhf.deb ...
Unpacking libgssapi-krb5-2:armhf (1.18.3-4) ...
Selecting previously unselected package libtirpc-common.
Preparing to unpack .../05-libtirpc-common_1.2.6-3_all.deb ...
Unpacking libtirpc-common (1.2.6-3) ...
Selecting previously unselected package libtirpc3:armhf.
Preparing to unpack .../06-libtirpc3_1.2.6-3_armhf.deb ...
Unpacking libtirpc3:armhf (1.2.6-3) ...
Selecting previously unselected package libnsl2:armhf.
Preparing to unpack .../07-libnsl2_1.3.0-2_armhf.deb ...
Unpacking libnsl2:armhf (1.3.0-2) ...
Selecting previously unselected package libpython3.9-stdlib:armhf.
Preparing to unpack .../08-libpython3.9-stdlib_3.9.1~rc1-2+rpi1_armhf.deb ...
Unpacking libpython3.9-stdlib:armhf (3.9.1~rc1-2+rpi1) ...
Selecting previously unselected package python3.9.
Preparing to unpack .../09-python3.9_3.9.1~rc1-2+rpi1_armhf.deb ...
Unpacking python3.9 (3.9.1~rc1-2+rpi1) ...
Selecting previously unselected package libpython3-stdlib:armhf.
Preparing to unpack .../10-libpython3-stdlib_3.9.0-4_armhf.deb ...
Unpacking libpython3-stdlib:armhf (3.9.0-4) ...
Setting up python3-minimal (3.9.0-4) ...
Selecting previously unselected package python3.
(Reading database ... 13891 files and directories currently installed.)
Preparing to unpack .../00-python3_3.9.0-4_armhf.deb ...
Unpacking python3 (3.9.0-4) ...
Selecting previously unselected package libncurses6:armhf.
Preparing to unpack .../01-libncurses6_6.2+20201114-1_armhf.deb ...
Unpacking libncurses6:armhf (6.2+20201114-1) ...
Selecting previously unselected package libprocps8:armhf.
Preparing to unpack .../02-libprocps8_2%3a3.3.16-5_armhf.deb ...
Unpacking libprocps8:armhf (2:3.3.16-5) ...
Selecting previously unselected package procps.
Preparing to unpack .../03-procps_2%3a3.3.16-5_armhf.deb ...
Unpacking procps (2:3.3.16-5) ...
Selecting previously unselected package libmagic-mgc.
Preparing to unpack .../04-libmagic-mgc_1%3a5.38-5_armhf.deb ...
Unpacking libmagic-mgc (1:5.38-5) ...
Selecting previously unselected package libmagic1:armhf.
Preparing to unpack .../05-libmagic1_1%3a5.38-5_armhf.deb ...
Unpacking libmagic1:armhf (1:5.38-5) ...
Selecting previously unselected package file.
Preparing to unpack .../06-file_1%3a5.38-5_armhf.deb ...
Unpacking file (1:5.38-5) ...
Selecting previously unselected package gettext-base.
Preparing to unpack .../07-gettext-base_0.19.8.1-10_armhf.deb ...
Unpacking gettext-base (0.19.8.1-10) ...
Selecting previously unselected package libsigsegv2:armhf.
Preparing to unpack .../08-libsigsegv2_2.12-2_armhf.deb ...
Unpacking libsigsegv2:armhf (2.12-2) ...
Selecting previously unselected package m4.
Preparing to unpack .../09-m4_1.4.18-4_armhf.deb ...
Unpacking m4 (1.4.18-4) ...
Selecting previously unselected package autoconf.
Preparing to unpack .../10-autoconf_2.69-11.1_all.deb ...
Unpacking autoconf (2.69-11.1) ...
Selecting previously unselected package autotools-dev.
Preparing to unpack .../11-autotools-dev_20180224.1_all.deb ...
Unpacking autotools-dev (20180224.1) ...
Selecting previously unselected package automake.
Preparing to unpack .../12-automake_1%3a1.16.2-4_all.deb ...
Unpacking automake (1:1.16.2-4) ...
Selecting previously unselected package autopoint.
Preparing to unpack .../13-autopoint_0.19.8.1-10_all.deb ...
Unpacking autopoint (0.19.8.1-10) ...
Selecting previously unselected package cmake-data.
Preparing to unpack .../14-cmake-data_3.18.4-1+rpi1_all.deb ...
Unpacking cmake-data (3.18.4-1+rpi1) ...
Selecting previously unselected package libicu67:armhf.
Preparing to unpack .../15-libicu67_67.1-4_armhf.deb ...
Unpacking libicu67:armhf (67.1-4) ...
Selecting previously unselected package libxml2:armhf.
Preparing to unpack .../16-libxml2_2.9.10+dfsg-6.3_armhf.deb ...
Unpacking libxml2:armhf (2.9.10+dfsg-6.3) ...
Selecting previously unselected package libarchive13:armhf.
Preparing to unpack .../17-libarchive13_3.4.3-2_armhf.deb ...
Unpacking libarchive13:armhf (3.4.3-2) ...
Selecting previously unselected package libbrotli1:armhf.
Preparing to unpack .../18-libbrotli1_1.0.9-2+b1_armhf.deb ...
Unpacking libbrotli1:armhf (1.0.9-2+b1) ...
Selecting previously unselected package libnghttp2-14:armhf.
Preparing to unpack .../19-libnghttp2-14_1.42.0-1_armhf.deb ...
Unpacking libnghttp2-14:armhf (1.42.0-1) ...
Selecting previously unselected package libpsl5:armhf.
Preparing to unpack .../20-libpsl5_0.21.0-1.1_armhf.deb ...
Unpacking libpsl5:armhf (0.21.0-1.1) ...
Selecting previously unselected package librtmp1:armhf.
Preparing to unpack .../21-librtmp1_2.4+20151223.gitfa8646d.1-2+b2_armhf.deb ...
Unpacking librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b2) ...
Selecting previously unselected package libssh2-1:armhf.
Preparing to unpack .../22-libssh2-1_1.8.0-2.1_armhf.deb ...
Unpacking libssh2-1:armhf (1.8.0-2.1) ...
Selecting previously unselected package libcurl4:armhf.
Preparing to unpack .../23-libcurl4_7.72.0-1_armhf.deb ...
Unpacking libcurl4:armhf (7.72.0-1) ...
Selecting previously unselected package libjsoncpp1:armhf.
Preparing to unpack .../24-libjsoncpp1_1.7.4-3.1_armhf.deb ...
Unpacking libjsoncpp1:armhf (1.7.4-3.1) ...
Selecting previously unselected package librhash0:armhf.
Preparing to unpack .../25-librhash0_1.4.0-1_armhf.deb ...
Unpacking librhash0:armhf (1.4.0-1) ...
Selecting previously unselected package libuv1:armhf.
Preparing to unpack .../26-libuv1_1.40.0-1_armhf.deb ...
Unpacking libuv1:armhf (1.40.0-1) ...
Selecting previously unselected package cmake.
Preparing to unpack .../27-cmake_3.18.4-1+rpi1_armhf.deb ...
Unpacking cmake (3.18.4-1+rpi1) ...
Selecting previously unselected package cython3.
Preparing to unpack .../28-cython3_0.29.21-3+b1_armhf.deb ...
Unpacking cython3 (0.29.21-3+b1) ...
Selecting previously unselected package d-shlibs.
Preparing to unpack .../29-d-shlibs_0.95_all.deb ...
Unpacking d-shlibs (0.95) ...
Selecting previously unselected package libtool.
Preparing to unpack .../30-libtool_2.4.6-14_all.deb ...
Unpacking libtool (2.4.6-14) ...
Selecting previously unselected package dh-autoreconf.
Preparing to unpack .../31-dh-autoreconf_19_all.deb ...
Unpacking dh-autoreconf (19) ...
Selecting previously unselected package libdebhelper-perl.
Preparing to unpack .../32-libdebhelper-perl_13.2.1_all.deb ...
Unpacking libdebhelper-perl (13.2.1) ...
Selecting previously unselected package libarchive-zip-perl.
Preparing to unpack .../33-libarchive-zip-perl_1.68-1_all.deb ...
Unpacking libarchive-zip-perl (1.68-1) ...
Selecting previously unselected package libsub-override-perl.
Preparing to unpack .../34-libsub-override-perl_0.09-2_all.deb ...
Unpacking libsub-override-perl (0.09-2) ...
Selecting previously unselected package libfile-stripnondeterminism-perl.
Preparing to unpack .../35-libfile-stripnondeterminism-perl_1.9.0-1_all.deb ...
Unpacking libfile-stripnondeterminism-perl (1.9.0-1) ...
Selecting previously unselected package dh-strip-nondeterminism.
Preparing to unpack .../36-dh-strip-nondeterminism_1.9.0-1_all.deb ...
Unpacking dh-strip-nondeterminism (1.9.0-1) ...
Selecting previously unselected package libelf1:armhf.
Preparing to unpack .../37-libelf1_0.182-1_armhf.deb ...
Unpacking libelf1:armhf (0.182-1) ...
Selecting previously unselected package dwz.
Preparing to unpack .../38-dwz_0.13-5_armhf.deb ...
Unpacking dwz (0.13-5) ...
Selecting previously unselected package libglib2.0-0:armhf.
Preparing to unpack .../39-libglib2.0-0_2.66.3-2_armhf.deb ...
Unpacking libglib2.0-0:armhf (2.66.3-2) ...
Selecting previously unselected package libcroco3:armhf.
Preparing to unpack .../40-libcroco3_0.6.13-1_armhf.deb ...
Unpacking libcroco3:armhf (0.6.13-1) ...
Selecting previously unselected package gettext.
Preparing to unpack .../41-gettext_0.19.8.1-10_armhf.deb ...
Unpacking gettext (0.19.8.1-10) ...
Selecting previously unselected package intltool-debian.
Preparing to unpack .../42-intltool-debian_0.35.0+20060710.5_all.deb ...
Unpacking intltool-debian (0.35.0+20060710.5) ...
Selecting previously unselected package po-debconf.
Preparing to unpack .../43-po-debconf_1.0.21_all.deb ...
Unpacking po-debconf (1.0.21) ...
Selecting previously unselected package debhelper.
Preparing to unpack .../44-debhelper_13.2.1_all.deb ...
Unpacking debhelper (13.2.1) ...
Selecting previously unselected package python3-lib2to3.
Preparing to unpack .../45-python3-lib2to3_3.8.6-1_all.deb ...
Unpacking python3-lib2to3 (3.8.6-1) ...
Selecting previously unselected package python3-distutils.
Preparing to unpack .../46-python3-distutils_3.8.6-1_all.deb ...
Unpacking python3-distutils (3.8.6-1) ...
Selecting previously unselected package dh-python.
Preparing to unpack .../47-dh-python_4.20201102_all.deb ...
Unpacking dh-python (4.20201102) ...
Selecting previously unselected package libexpat1-dev:armhf.
Preparing to unpack .../48-libexpat1-dev_2.2.10-1_armhf.deb ...
Unpacking libexpat1-dev:armhf (2.2.10-1) ...
Selecting previously unselected package libpython3.9:armhf.
Preparing to unpack .../49-libpython3.9_3.9.1~rc1-2+rpi1_armhf.deb ...
Unpacking libpython3.9:armhf (3.9.1~rc1-2+rpi1) ...
Selecting previously unselected package libpython3.9-dev:armhf.
Preparing to unpack .../50-libpython3.9-dev_3.9.1~rc1-2+rpi1_armhf.deb ...
Unpacking libpython3.9-dev:armhf (3.9.1~rc1-2+rpi1) ...
Selecting previously unselected package libpython3-dev:armhf.
Preparing to unpack .../51-libpython3-dev_3.9.0-4_armhf.deb ...
Unpacking libpython3-dev:armhf (3.9.0-4) ...
Selecting previously unselected package libpython3-all-dev:armhf.
Preparing to unpack .../52-libpython3-all-dev_3.9.0-4_armhf.deb ...
Unpacking libpython3-all-dev:armhf (3.9.0-4) ...
Selecting previously unselected package python3-all.
Preparing to unpack .../53-python3-all_3.9.0-4_armhf.deb ...
Unpacking python3-all (3.9.0-4) ...
Selecting previously unselected package zlib1g-dev:armhf.
Preparing to unpack .../54-zlib1g-dev_1%3a1.2.11.dfsg-2_armhf.deb ...
Unpacking zlib1g-dev:armhf (1:1.2.11.dfsg-2) ...
Selecting previously unselected package python3.9-dev.
Preparing to unpack .../55-python3.9-dev_3.9.1~rc1-2+rpi1_armhf.deb ...
Unpacking python3.9-dev (3.9.1~rc1-2+rpi1) ...
Selecting previously unselected package python3-dev.
Preparing to unpack .../56-python3-dev_3.9.0-4_armhf.deb ...
Unpacking python3-dev (3.9.0-4) ...
Selecting previously unselected package python3-all-dev.
Preparing to unpack .../57-python3-all-dev_3.9.0-4_armhf.deb ...
Unpacking python3-all-dev (3.9.0-4) ...
Selecting previously unselected package python3-pkg-resources.
Preparing to unpack .../58-python3-pkg-resources_50.3.0-1_all.deb ...
Unpacking python3-pkg-resources (50.3.0-1) ...
Selecting previously unselected package python3-setuptools.
Preparing to unpack .../59-python3-setuptools_50.3.0-1_all.deb ...
Unpacking python3-setuptools (50.3.0-1) ...
Selecting previously unselected package rename.
Preparing to unpack .../60-rename_1.13-1_all.deb ...
Unpacking rename (1.13-1) ...
Selecting previously unselected package sbuild-build-depends-libedlib-dummy.
Preparing to unpack .../61-sbuild-build-depends-libedlib-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-libedlib-dummy (0.invalid.0) ...
Setting up media-types (1.0.1) ...
Setting up libpipeline1:armhf (1.5.3-1) ...
Setting up libkeyutils1:armhf (1.6.1-2) ...
Setting up libpsl5:armhf (0.21.0-1.1) ...
Setting up libicu67:armhf (67.1-4) ...
Setting up libmagic-mgc (1:5.38-5) ...
Setting up libarchive-zip-perl (1.68-1) ...
Setting up libglib2.0-0:armhf (2.66.3-2) ...
No schema files found: doing nothing.
Setting up libtirpc-common (1.2.6-3) ...
Setting up libdebhelper-perl (13.2.1) ...
Setting up libbrotli1:armhf (1.0.9-2+b1) ...
Setting up libnghttp2-14:armhf (1.42.0-1) ...
Setting up libmagic1:armhf (1:5.38-5) ...
Setting up gettext-base (0.19.8.1-10) ...
Setting up rename (1.13-1) ...
update-alternatives: using /usr/bin/file-rename to provide /usr/bin/rename (rename) in auto mode
Setting up file (1:5.38-5) ...
Setting up libkrb5support0:armhf (1.18.3-4) ...
Setting up autotools-dev (20180224.1) ...
Setting up libuv1:armhf (1.40.0-1) ...
Setting up libexpat1-dev:armhf (2.2.10-1) ...
Setting up librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b2) ...
Setting up libncurses6:armhf (6.2+20201114-1) ...
Setting up libsigsegv2:armhf (2.12-2) ...
Setting up autopoint (0.19.8.1-10) ...
Setting up d-shlibs (0.95) ...
Setting up libk5crypto3:armhf (1.18.3-4) ...
Setting up zlib1g-dev:armhf (1:1.2.11.dfsg-2) ...
Setting up librhash0:armhf (1.4.0-1) ...
Setting up libuchardet0:armhf (0.0.7-1) ...
Setting up libsub-override-perl (0.09-2) ...
Setting up libssh2-1:armhf (1.8.0-2.1) ...
Setting up cmake-data (3.18.4-1+rpi1) ...
Setting up libkrb5-3:armhf (1.18.3-4) ...
Setting up mailcap (3.67) ...
Setting up libelf1:armhf (0.182-1) ...
Setting up libxml2:armhf (2.9.10+dfsg-6.3) ...
Setting up libprocps8:armhf (2:3.3.16-5) ...
Setting up libjsoncpp1:armhf (1.7.4-3.1) ...
Setting up libfile-stripnondeterminism-perl (1.9.0-1) ...
Setting up mime-support (3.66) ...
Setting up libtool (2.4.6-14) ...
Setting up libarchive13:armhf (3.4.3-2) ...
Setting up m4 (1.4.18-4) ...
Setting up libgssapi-krb5-2:armhf (1.18.3-4) ...
Setting up libcroco3:armhf (0.6.13-1) ...
Setting up autoconf (2.69-11.1) ...
Setting up dh-strip-nondeterminism (1.9.0-1) ...
Setting up dwz (0.13-5) ...
Setting up groff-base (1.22.4-5) ...
Setting up procps (2:3.3.16-5) ...
update-alternatives: using /usr/bin/w.procps to provide /usr/bin/w (w) in auto mode
Setting up libcurl4:armhf (7.72.0-1) ...
Setting up automake (1:1.16.2-4) ...
update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode
Setting up libtirpc3:armhf (1.2.6-3) ...
Setting up gettext (0.19.8.1-10) ...
Setting up man-db (2.9.3-2) ...
Not building database; man-db/auto-update is not 'true'.
Setting up intltool-debian (0.35.0+20060710.5) ...
Setting up libnsl2:armhf (1.3.0-2) ...
Setting up cmake (3.18.4-1+rpi1) ...
Setting up libpython3.9-stdlib:armhf (3.9.1~rc1-2+rpi1) ...
Setting up libpython3-stdlib:armhf (3.9.0-4) ...
Setting up po-debconf (1.0.21) ...
Setting up libpython3.9:armhf (3.9.1~rc1-2+rpi1) ...
Setting up python3.9 (3.9.1~rc1-2+rpi1) ...
Setting up libpython3.9-dev:armhf (3.9.1~rc1-2+rpi1) ...
Setting up python3 (3.9.0-4) ...
Setting up cython3 (0.29.21-3+b1) ...
Setting up python3.9-dev (3.9.1~rc1-2+rpi1) ...
Setting up python3-lib2to3 (3.8.6-1) ...
Setting up python3-pkg-resources (50.3.0-1) ...
Setting up python3-distutils (3.8.6-1) ...
Setting up dh-python (4.20201102) ...
Setting up libpython3-dev:armhf (3.9.0-4) ...
Setting up python3-setuptools (50.3.0-1) ...
Setting up python3-all (3.9.0-4) ...
Setting up libpython3-all-dev:armhf (3.9.0-4) ...
Setting up python3-dev (3.9.0-4) ...
Setting up python3-all-dev (3.9.0-4) ...
Setting up dh-autoreconf (19) ...
Setting up debhelper (13.2.1) ...
Setting up sbuild-build-depends-libedlib-dummy (0.invalid.0) ...
Processing triggers for libc-bin (2.31-4+rpi1) ...
W: No sandbox user '_apt' on the system, can not drop privileges
+------------------------------------------------------------------------------+
| Build environment |
+------------------------------------------------------------------------------+
Kernel: Linux 4.15.0-76-generic armhf (armv8l)
Toolchain package versions: binutils_2.35.1-2+rpi1 dpkg-dev_1.20.5+rpi1 g++-10_10.2.0-16+rpi1 gcc-10_10.2.0-16+rpi1 libc6-dev_2.31-3+rpi1 libstdc++-10-dev_10.2.0-16+rpi1 libstdc++6_10.2.0-16+rpi1 linux-libc-dev_5.7.10-1+rpi1
Package versions: adduser_3.118 apt_2.1.11 aptitude_0.8.13-2 aptitude-common_0.8.13-2 autoconf_2.69-11.1 automake_1:1.16.2-4 autopoint_0.19.8.1-10 autotools-dev_20180224.1 base-files_11+rpi1 base-passwd_3.5.48 bash_5.1~rc2-1 binutils_2.35.1-2+rpi1 binutils-arm-linux-gnueabihf_2.35.1-2+rpi1 binutils-common_2.35.1-2+rpi1 bsdextrautils_2.36-3 bsdutils_1:2.36-3 build-essential_12.8 bzip2_1.0.8-4 cmake_3.18.4-1+rpi1 cmake-data_3.18.4-1+rpi1 coreutils_8.32-4 cpp_4:10.2.0-1+rpi1 cpp-10_10.2.0-16+rpi1 cython3_0.29.21-3+b1 d-shlibs_0.95 dash_0.5.11+git20200708+dd9ef66-2 debconf_1.5.74 debhelper_13.2.1 debianutils_4.11.2 dh-autoreconf_19 dh-python_4.20201102 dh-strip-nondeterminism_1.9.0-1 diffutils_1:3.7-3 dirmngr_2.2.20-1 dpkg_1.20.5+rpi1 dpkg-dev_1.20.5+rpi1 dwz_0.13-5 e2fsprogs_1.45.6-1 fakeroot_1.25.3-1 fdisk_2.36-3 file_1:5.38-5 findutils_4.7.0+git20201010-2 g++_4:10.2.0-1+rpi1 g++-10_10.2.0-16+rpi1 gcc_4:10.2.0-1+rpi1 gcc-10_10.2.0-16+rpi1 gcc-10-base_10.2.0-16+rpi1 gettext_0.19.8.1-10 gettext-base_0.19.8.1-10 gnupg_2.2.20-1 gnupg-l10n_2.2.20-1 gnupg-utils_2.2.20-1 gpg_2.2.20-1 gpg-agent_2.2.20-1 gpg-wks-client_2.2.20-1 gpg-wks-server_2.2.20-1 gpgconf_2.2.20-1 gpgsm_2.2.20-1 gpgv_2.2.20-1 grep_3.6-1 groff-base_1.22.4-5 gzip_1.10-2 hostname_3.23 init-system-helpers_1.58 intltool-debian_0.35.0+20060710.5 iputils-ping_3:20200821-2 libacl1_2.2.53-8 libapt-pkg6.0_2.1.11 libarchive-zip-perl_1.68-1 libarchive13_3.4.3-2 libasan6_10.2.0-16+rpi1 libassuan0_2.5.3-7.1 libatomic1_10.2.0-16+rpi1 libattr1_1:2.4.48-5 libaudit-common_1:2.8.5-3.1 libaudit1_1:2.8.5-3.1 libbinutils_2.35.1-2+rpi1 libblkid1_2.36-3 libboost-iostreams1.71.0_1.71.0-7 libbrotli1_1.0.9-2+b1 libbz2-1.0_1.0.8-4 libc-bin_2.31-4+rpi1 libc-dev-bin_2.31-3+rpi1 libc6_2.31-3+rpi1 libc6-dev_2.31-3+rpi1 libcap-ng0_0.7.9-2.2 libcap2_1:2.44-1 libcap2-bin_1:2.44-1 libcc1-0_10.2.0-16+rpi1 libcom-err2_1.45.6-1 libcroco3_0.6.13-1 libcrypt-dev_1:4.4.17-1 libcrypt1_1:4.4.17-1 libctf-nobfd0_2.35.1-2+rpi1 libctf0_2.35.1-2+rpi1 libcurl4_7.72.0-1 libcwidget4_0.5.18-5 libdb5.3_5.3.28+dfsg1-0.6 libdebconfclient0_0.255 libdebhelper-perl_13.2.1 libdpkg-perl_1.20.5+rpi1 libelf1_0.182-1 libexpat1_2.2.10-1 libexpat1-dev_2.2.10-1 libext2fs2_1.45.6-1 libfakeroot_1.25.3-1 libfdisk1_2.36-3 libffi7_3.3-5 libfile-stripnondeterminism-perl_1.9.0-1 libgcc-10-dev_10.2.0-16+rpi1 libgcc-s1_10.2.0-16+rpi1 libgcrypt20_1.8.7-2 libgdbm-compat4_1.18.1-5.1 libgdbm6_1.18.1-5.1 libglib2.0-0_2.66.3-2 libgmp10_2:6.2.0+dfsg-6 libgnutls30_3.6.15-4 libgomp1_10.2.0-16+rpi1 libgpg-error0_1.38-2 libgssapi-krb5-2_1.18.3-4 libhogweed6_3.6-2 libicu67_67.1-4 libidn2-0_2.3.0-3 libisl22_0.22.1-1 libjsoncpp1_1.7.4-3.1 libk5crypto3_1.18.3-4 libkeyutils1_1.6.1-2 libkrb5-3_1.18.3-4 libkrb5support0_1.18.3-4 libksba8_1.4.0-2 libldap-2.4-2_2.4.56+dfsg-1 libldap-common_2.4.56+dfsg-1 liblz4-1_1.9.2-2 liblzma5_5.2.4-1 libmagic-mgc_1:5.38-5 libmagic1_1:5.38-5 libmount1_2.36-3 libmpc3_1.2.0-1 libmpfr6_4.1.0-3 libncurses6_6.2+20201114-1 libncursesw6_6.2+20201114-1 libnettle8_3.6-2 libnghttp2-14_1.42.0-1 libnpth0_1.6-3 libnsl2_1.3.0-2 libp11-kit0_0.23.21-2 libpam-cap_1:2.44-1 libpam-modules_1.3.1-5 libpam-modules-bin_1.3.1-5 libpam-runtime_1.3.1-5 libpam0g_1.3.1-5 libpcre2-8-0_10.34-7 libpcre3_2:8.39-13 libperl5.32_5.32.0-5 libpipeline1_1.5.3-1 libprocps8_2:3.3.16-5 libpsl5_0.21.0-1.1 libpython3-all-dev_3.9.0-4 libpython3-dev_3.9.0-4 libpython3-stdlib_3.9.0-4 libpython3.9_3.9.1~rc1-2+rpi1 libpython3.9-dev_3.9.1~rc1-2+rpi1 libpython3.9-minimal_3.9.1~rc1-2+rpi1 libpython3.9-stdlib_3.9.1~rc1-2+rpi1 libreadline8_8.1~rc2-2 librhash0_1.4.0-1 librtmp1_2.4+20151223.gitfa8646d.1-2+b2 libsasl2-2_2.1.27+dfsg-2 libsasl2-modules-db_2.1.27+dfsg-2 libseccomp2_2.5.0-3+rpi1 libselinux1_3.1-2 libsemanage-common_3.1-1 libsemanage1_3.1-1 libsepol1_3.1-1 libsigc++-2.0-0v5_2.10.4-2 libsigsegv2_2.12-2 libsmartcols1_2.36-3 libsqlite3-0_3.33.0-1 libss2_1.45.6-1 libssh2-1_1.8.0-2.1 libssl1.1_1.1.1h-1 libstdc++-10-dev_10.2.0-16+rpi1 libstdc++6_10.2.0-16+rpi1 libsub-override-perl_0.09-2 libsystemd0_246.6-2+rpi1 libtasn1-6_4.16.0-2 libtinfo6_6.2+20201114-1 libtirpc-common_1.2.6-3 libtirpc3_1.2.6-3 libtool_2.4.6-14 libubsan1_10.2.0-16+rpi1 libuchardet0_0.0.7-1 libudev1_246.6-2+rpi1 libunistring2_0.9.10-4 libuuid1_2.36-3 libuv1_1.40.0-1 libxapian30_1.4.17-1 libxml2_2.9.10+dfsg-6.3 libzstd1_1.4.5+dfsg-4+rpi1 linux-libc-dev_5.7.10-1+rpi1 login_1:4.8.1-1 logsave_1.45.6-1 lsb-base_11.1.0+rpi1 m4_1.4.18-4 mailcap_3.67 make_4.3-4 man-db_2.9.3-2 mawk_1.3.4.20200120-2 media-types_1.0.1 mime-support_3.66 mount_2.36-3 ncurses-base_6.2+20200918-1 ncurses-bin_6.2+20200918-1 netbase_6.2 passwd_1:4.8.1-1 patch_2.7.6-6 perl_5.32.0-5 perl-base_5.32.0-5 perl-modules-5.32_5.32.0-5 pinentry-curses_1.1.0-4 po-debconf_1.0.21 procps_2:3.3.16-5 python3_3.9.0-4 python3-all_3.9.0-4 python3-all-dev_3.9.0-4 python3-dev_3.9.0-4 python3-distutils_3.8.6-1 python3-lib2to3_3.8.6-1 python3-minimal_3.9.0-4 python3-pkg-resources_50.3.0-1 python3-setuptools_50.3.0-1 python3.9_3.9.1~rc1-2+rpi1 python3.9-dev_3.9.1~rc1-2+rpi1 python3.9-minimal_3.9.1~rc1-2+rpi1 raspbian-archive-keyring_20120528.2 readline-common_8.1~rc2-2 rename_1.13-1 sbuild-build-depends-core-dummy_0.invalid.0 sbuild-build-depends-libedlib-dummy_0.invalid.0 sed_4.7-1 sensible-utils_0.0.12+nmu1 sysvinit-utils_2.96-5 tar_1.30+dfsg-7 tzdata_2020d-1 util-linux_2.36-3 xz-utils_5.2.4-1 zlib1g_1:1.2.11.dfsg-2 zlib1g-dev_1:1.2.11.dfsg-2
+------------------------------------------------------------------------------+
| Build |
+------------------------------------------------------------------------------+
Unpack source
-------------
gpgv: unknown type of key resource 'trustedkeys.kbx'
gpgv: keyblock resource '/tmp/dpkg-verify-sig.PYbfmk7D/trustedkeys.kbx': General error
gpgv: Signature made Sun Aug 18 13:55:54 2019 UTC
gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1
gpgv: issuer "tille@debian.org"
gpgv: Can't check signature: No public key
dpkg-source: warning: failed to verify signature on ./libedlib_1.2.4-2.dsc
dpkg-source: info: extracting libedlib in /<<PKGBUILDDIR>>
dpkg-source: info: unpacking libedlib_1.2.4.orig.tar.gz
dpkg-source: info: unpacking libedlib_1.2.4-2.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying soversion.patch
dpkg-source: info: applying do_not_build_hello_example.patch
dpkg-source: info: applying cython3.patch
Check disk space
----------------
Sufficient free space for build
Hack binNMU version
-------------------
Created changelog entry for binNMU version 1.2.4-2+b2
User Environment
----------------
APT_CONFIG=/var/lib/sbuild/apt.conf
DEB_BUILD_OPTIONS=parallel=4
HOME=/sbuild-nonexistent
LC_ALL=POSIX
LOGNAME=buildd
PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games
SCHROOT_ALIAS_NAME=bullseye-staging-armhf-sbuild
SCHROOT_CHROOT_NAME=bullseye-staging-armhf-sbuild
SCHROOT_COMMAND=env
SCHROOT_GID=112
SCHROOT_GROUP=buildd
SCHROOT_SESSION_ID=bullseye-staging-armhf-sbuild-12185115-f27a-45f3-918c-e5d3709454c8
SCHROOT_UID=107
SCHROOT_USER=buildd
SHELL=/bin/sh
USER=buildd
dpkg-buildpackage
-----------------
dpkg-buildpackage: info: source package libedlib
dpkg-buildpackage: info: source version 1.2.4-2+b2
dpkg-buildpackage: info: source distribution bullseye-staging
dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
fakeroot debian/rules clean
dh clean --with python3
dh_clean
debian/rules build-arch
dh build-arch --with python3
dh_update_autotools_config -a
dh_autoreconf -a
debian/rules override_dh_auto_configure
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_configure --buildsystem=cmake -- -DCMAKE_BUILD_TYPE=Release
cd obj-arm-linux-gnueabihf && cmake -DCMAKE_INSTALL_PREFIX=/usr -DCMAKE_BUILD_TYPE=None -DCMAKE_INSTALL_SYSCONFDIR=/etc -DCMAKE_INSTALL_LOCALSTATEDIR=/var -DCMAKE_EXPORT_NO_PACKAGE_REGISTRY=ON -DCMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY=ON -DCMAKE_INSTALL_RUNSTATEDIR=/run "-GUnix Makefiles" -DCMAKE_VERBOSE_MAKEFILE=ON -DCMAKE_INSTALL_LIBDIR=lib/arm-linux-gnueabihf -DCMAKE_BUILD_TYPE=Release ..
-- The CXX compiler identification is GNU 10.2.0
-- Detecting CXX compiler ABI info
-- Detecting CXX compiler ABI info - done
-- Check for working CXX compiler: /usr/bin/c++ - skipped
-- Detecting CXX compile features
-- Detecting CXX compile features - done
Setting warning flags
-- Configuring done
-- Generating done
CMake Warning:
Manually-specified variables were not used by the project:
CMAKE_EXPORT_NO_PACKAGE_REGISTRY
CMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY
CMAKE_INSTALL_LIBDIR
CMAKE_INSTALL_LOCALSTATEDIR
CMAKE_INSTALL_RUNSTATEDIR
CMAKE_INSTALL_SYSCONFDIR
-- Build files have been written to: /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_auto_build
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_build --buildsystem=cmake
cd obj-arm-linux-gnueabihf && make -j4 "INSTALL=install --strip-program=true"
make[2]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -S/<<PKGBUILDDIR>> -B/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf//CMakeFiles/progress.marks
make -f CMakeFiles/Makefile2 all
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake --color=
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake --color=
Scanning dependencies of target edlib_static
Scanning dependencies of target edlib
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 25%] Building CXX object CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o
[ 25%] Building CXX object CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o
/usr/bin/c++ -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -c /<<PKGBUILDDIR>>/edlib/src/edlib.cpp
/usr/bin/c++ -Dedlib_EXPORTS -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -fPIC -std=c++11 -o CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -c /<<PKGBUILDDIR>>/edlib/src/edlib.cpp
[ 37%] Linking CXX shared library lib/libedlib.so
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib.dir/link.txt --verbose=1
/usr/bin/c++ -fPIC -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -shared -Wl,-soname,libedlib.so.0 -o lib/libedlib.so.1.2.3 CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o
[ 50%] Linking CXX static library lib/libedlib_static.a
/usr/bin/cmake -P CMakeFiles/edlib_static.dir/cmake_clean_target.cmake
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib_static.dir/link.txt --verbose=1
/usr/bin/ar qc lib/libedlib_static.a CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o
/usr/bin/ranlib lib/libedlib_static.a
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 50%] Built target edlib_static
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color=
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/DependInfo.cmake --color=
Scanning dependencies of target edlib-aligner
Scanning dependencies of target runTests
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build
/usr/bin/cmake -E cmake_symlink_library lib/libedlib.so.1.2.3 lib/libedlib.so.0 lib/libedlib.so
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 62%] Building CXX object CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o
[ 75%] Building CXX object CMakeFiles/runTests.dir/test/runTests.cpp.o
/usr/bin/c++ -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -c /<<PKGBUILDDIR>>/apps/aligner/aligner.cpp
/usr/bin/c++ -I/<<PKGBUILDDIR>>/edlib/include -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/runTests.dir/test/runTests.cpp.o -c /<<PKGBUILDDIR>>/test/runTests.cpp
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 75%] Built target edlib
/<<PKGBUILDDIR>>/apps/aligner/aligner.cpp: In function 'void printAlignment(const char*, const char*, const unsigned char*, int, int, EdlibAlignMode)':
/<<PKGBUILDDIR>>/apps/aligner/aligner.cpp:346:13: warning: 'startTIdx' may be used uninitialized in this function [-Wmaybe-uninitialized]
346 | int startTIdx;
| ^~~~~~~~~
[ 87%] Linking CXX executable bin/runTests
/usr/bin/cmake -E cmake_link_script CMakeFiles/runTests.dir/link.txt --verbose=1
/usr/bin/c++ -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/runTests.dir/test/runTests.cpp.o -o bin/runTests lib/libedlib_static.a
[100%] Linking CXX executable bin/edlib-aligner
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib-aligner.dir/link.txt --verbose=1
/usr/bin/c++ -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -o bin/edlib-aligner lib/libedlib_static.a
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[100%] Built target runTests
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[100%] Built target edlib-aligner
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles 0
make[2]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
# /usr/bin/make --directory=bindings/python
/usr/bin/make --directory=bindings/python edlib pyedlib.bycython.cpp
make[2]: Entering directory '/<<PKGBUILDDIR>>/bindings/python'
cp -R ../../edlib .
cython3 --cplus edlib.pyx -o edlib.bycython.cpp
/usr/lib/python3/dist-packages/Cython/Compiler/Main.py:369: FutureWarning: Cython directive 'language_level' not set, using 2 for now (Py2). This will change in a later release! File: /<<PKGBUILDDIR>>/bindings/python/edlib.pyx
tree = Parsing.p_module(s, pxd, full_module_name)
make[2]: Leaving directory '/<<PKGBUILDDIR>>/bindings/python'
dh_auto_build --buildsystem=pybuild -- --dir bindings/python
I: pybuild base:232: /usr/bin/python3 setup.py build
/usr/lib/python3/dist-packages/setuptools/dist.py:452: UserWarning: Normalizing '1.2.3-1' to '1.2.3.post1'
warnings.warn(tmpl.format(**locals()))
running build
running build_ext
building 'edlib' extension
creating build
creating build/temp.linux-armhf-3.9
creating build/temp.linux-armhf-3.9/edlib
creating build/temp.linux-armhf-3.9/edlib/src
arm-linux-gnueabihf-gcc -pthread -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.9 -c edlib.bycython.cpp -o build/temp.linux-armhf-3.9/edlib.bycython.o -O3 -std=c++11
edlib.bycython.cpp: In function 'PyObject* __pyx_pf_5edlib_align(PyObject*, PyObject*, PyObject*, PyObject*, PyObject*, PyObject*, PyObject*)':
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
1424 | static PyObject *__pyx_pf_5edlib_align(CYTHON_UNUSED PyObject *__pyx_self, PyObject *__pyx_v_query, PyObject *__pyx_v_target, PyObject *__pyx_v_mode, PyObject *__pyx_v_task, PyObject *__pyx_v_k, PyObject *__pyx_v_additionalEqualities) {
| ^~~~~~~~~~~~~~~~~~~~~
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
edlib.bycython.cpp:1424:18: note: non-delegitimized UNSPEC UNSPEC_PIC_SYM (1) found in variable location
arm-linux-gnueabihf-gcc -pthread -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.9 -c edlib/src/edlib.cpp -o build/temp.linux-armhf-3.9/edlib/src/edlib.o -O3 -std=c++11
arm-linux-gnueabihf-g++ -pthread -shared -Wl,-O1 -Wl,-Bsymbolic-functions -Wl,-z,relro -g -fwrapv -O2 -Wl,-z,relro -Wl,-z,now -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 build/temp.linux-armhf-3.9/edlib.bycython.o build/temp.linux-armhf-3.9/edlib/src/edlib.o -o /<<PKGBUILDDIR>>/.pybuild/cpython3_3.9_edlib/build/edlib.cpython-39-arm-linux-gnueabihf.so
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_auto_test
make[1]: Entering directory '/<<PKGBUILDDIR>>'
`find . -name edlib-aligner -type f -executable` -p apps/aligner/test_data/query.fasta apps/aligner/test_data/target.fasta
Using NW alignment mode.
Reading queries...
Read 1 queries, 110 residues total.
Reading target fasta file...
Read target, 109 residues.
Comparing queries to target...
Query #0 (110 residues): score = 17
T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48)
||||||| | |||||||||| |||||||||||||||||||||||||||
Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46)
T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92)
| |||||||||||| || |||||||||| ||||||||| |||||| |
Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94)
T: AESIKSKKKKKE-STTB (93 - 108)
||||||||||| |||
Q: -ESIKSKKKKKENSTT- (94 - 109)
Cpu time of searching: 0.000752
`find . -name runTests`
Testing HW with alignment...
HW: [32m100/100[0m random tests passed!
Time Edlib: 0.101014
Time Simple: 0.456061
Times faster: 4.51
Testing HW...
HW: [32m100/100[0m random tests passed!
Time Edlib: 0.087666
Time Simple: 0.484280
Times faster: 5.52
Testing NW with alignment...
NW: [32m100/100[0m random tests passed!
Time Edlib: 0.192107
Time Simple: 0.505717
Times faster: 2.63
Testing NW...
NW: [32m100/100[0m random tests passed!
Time Edlib: 0.041992
Time Simple: 0.417554
Times faster: 9.94
Testing SHW with alignment...
SHW: [32m100/100[0m random tests passed!
Time Edlib: 0.013015
Time Simple: 0.457907
Times faster: 35.18
Testing SHW...
SHW: [32m100/100[0m random tests passed!
Time Edlib: 0.007951
Time Simple: 0.443272
Times faster: 55.75
Specific tests:
Test #0:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #1:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #2:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #3:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #4:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #5:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #6:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #7:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #8:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #9:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #10:
HW: [32m OK [0m
NW: [32m OK [0m
SHW: [32m OK [0m
Test #11:
[32mOK[0m
Test #12:
[32mOK[0m
Test #13:
[32mOK[0m
Test #14:
[32mOK[0m
Test #15:
[32mOK[0m
Test #16:
Cigar extended: [32mOK[0m
Cigar standard: [32mOK[0m
Test #17:
Degenerate nucleotides (HW): [32mOK[0m
All specific tests passed!
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
create-stamp debian/debhelper-build-stamp
fakeroot debian/rules binary-arch
dh binary-arch --with python3
dh_testroot -a
dh_prep -a
debian/rules override_dh_auto_install
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_install --buildsystem=cmake
cd obj-arm-linux-gnueabihf && make -j4 install DESTDIR=/<<PKGBUILDDIR>>/debian/tmp AM_UPDATE_INFO_DIR=no "INSTALL=install --strip-program=true"
make[2]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -S/<<PKGBUILDDIR>> -B/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf//CMakeFiles/progress.marks
make -f CMakeFiles/Makefile2 all
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake --color=
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake --color=
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/edlib_static.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/edlib.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 50%] Built target edlib
[ 50%] Built target edlib_static
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color=
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/DependInfo.cmake --color=
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/edlib-aligner.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/runTests.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 75%] Built target edlib-aligner
[100%] Built target runTests
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles 0
make -f CMakeFiles/Makefile2 preinstall
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[3]: Nothing to be done for 'preinstall'.
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
Install the project...
/usr/bin/cmake -P cmake_install.cmake
-- Install configuration: "Release"
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib.so.1.2.3
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib.so.0
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib.so
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib_static.a
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/include/edlib.h
make[2]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
dh_auto_install --buildsystem=pybuild -- --dir bindings/python
I: pybuild base:232: /usr/bin/python3 setup.py install --root /<<PKGBUILDDIR>>/debian/python3-edlib
/usr/lib/python3/dist-packages/setuptools/dist.py:452: UserWarning: Normalizing '1.2.3-1' to '1.2.3.post1'
warnings.warn(tmpl.format(**locals()))
running install
running build
running build_ext
running install_lib
creating /<<PKGBUILDDIR>>/debian/python3-edlib
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9/dist-packages
copying /<<PKGBUILDDIR>>/.pybuild/cpython3_3.9_edlib/build/edlib.cpython-39-arm-linux-gnueabihf.so -> /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9/dist-packages
running install_egg_info
running egg_info
creating edlib.egg-info
writing edlib.egg-info/PKG-INFO
writing dependency_links to edlib.egg-info/dependency_links.txt
writing top-level names to edlib.egg-info/top_level.txt
writing manifest file 'edlib.egg-info/SOURCES.txt'
reading manifest file 'edlib.egg-info/SOURCES.txt'
reading manifest template 'MANIFEST.in'
writing manifest file 'edlib.egg-info/SOURCES.txt'
Copying edlib.egg-info to /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.9/dist-packages/edlib-1.2.3.post1.egg-info
Skipping SOURCES.txt
running install_scripts
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
debian/rules override_dh_install
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_install
file-rename 's/_static\.a/.a/' `find debian -name libedlib_static.a`
d-shlibmove --commit \
--multiarch \
--devunversioned \
--exclude-la \
--movedev debian/tmp/usr/include/* usr/include \
debian/tmp/usr/lib/*.so
Library package automatic movement utility
set -e
install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
install -d -m 755 debian/libedlib0/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/libedlib.a debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/libedlib.so debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib.so.0 debian/libedlib0/usr/lib/arm-linux-gnueabihf
mv /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib.so.1.2.3 debian/libedlib0/usr/lib/arm-linux-gnueabihf
PKGDEV=libedlib-dev
PKGSHL=libedlib0
install -d -m 755 debian/libedlib-dev/usr/include
mv debian/tmp/usr/include/edlib.h debian/libedlib-dev/usr/include
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
dh_installdocs -a
dh_installchangelogs -a
dh_installexamples -a
dh_installman -a
dh_python3 -a
dh_perl -a
dh_link -a
dh_strip_nondeterminism -a
dh_compress -a
dh_fixperms -a
dh_missing -a
dh_dwz -a
dh_strip -a
dh_makeshlibs -a
dh_shlibdeps -a
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/edlib-aligner/usr/bin/edlib-aligner was not linked against ld-linux-armhf.so.3 (it uses none of the library's symbols)
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/python3-edlib/usr/lib/python3/dist-packages/edlib.cpython-39-arm-linux-gnueabihf.so was not linked against libpthread.so.0 (it uses none of the library's symbols)
dh_installdeb -a
dh_gencontrol -a
dpkg-gencontrol: warning: Depends field of package libedlib-dev: substitution variable ${shlibs:Depends} used, but is not defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined
dh_md5sums -a
dh_builddeb -a
dpkg-deb: building package 'libedlib0' in '../libedlib0_1.2.4-2+b2_armhf.deb'.
dpkg-deb: building package 'edlib-aligner-dbgsym' in '../edlib-aligner-dbgsym_1.2.4-2+b2_armhf.deb'.
dpkg-deb: building package 'python3-edlib-dbgsym' in '../python3-edlib-dbgsym_1.2.4-2+b2_armhf.deb'.
dpkg-deb: building package 'libedlib-dev' in '../libedlib-dev_1.2.4-2+b2_armhf.deb'.
dpkg-deb: building package 'libedlib0-dbgsym' in '../libedlib0-dbgsym_1.2.4-2+b2_armhf.deb'.
dpkg-deb: building package 'edlib-aligner' in '../edlib-aligner_1.2.4-2+b2_armhf.deb'.
dpkg-deb: building package 'python3-edlib' in '../python3-edlib_1.2.4-2+b2_armhf.deb'.
dpkg-genbuildinfo --build=any
dpkg-genchanges --build=any -mRaspbian mythic lxc autobuilder 1 <root@raspbian.org> >../libedlib_1.2.4-2+b2_armhf.changes
dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included)
dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
--------------------------------------------------------------------------------
Build finished at 2020-12-09T10:46:12Z
Finished
--------
I: Built successfully
+------------------------------------------------------------------------------+
| Post Build Chroot |
+------------------------------------------------------------------------------+
+------------------------------------------------------------------------------+
| Changes |
+------------------------------------------------------------------------------+
libedlib_1.2.4-2+b2_armhf.changes:
----------------------------------
Format: 1.8
Date: Sun, 18 Aug 2019 15:49:41 +0200
Source: libedlib (1.2.4-2)
Binary: edlib-aligner edlib-aligner-dbgsym libedlib-dev libedlib0 libedlib0-dbgsym python3-edlib python3-edlib-dbgsym
Binary-Only: yes
Architecture: armhf
Version: 1.2.4-2+b2
Distribution: bullseye-staging
Urgency: low
Maintainer: Raspbian mythic lxc autobuilder 1 <root@raspbian.org>
Changed-By: Raspbian mythic lxc autobuilder 1 <root@raspbian.org>
Description:
edlib-aligner - edlib sequence alignment tool using edit distance
libedlib-dev - library for sequence alignment using edit distance (devel)
libedlib0 - library for sequence alignment using edit distance
python3-edlib - library for sequence alignment using edit distance (Python3 modul
Changes:
libedlib (1.2.4-2+b2) bullseye-staging; urgency=low, binary-only=yes
.
* Binary-only non-maintainer upload for armhf; no source changes.
* rebuild due to debcheck failure
Checksums-Sha1:
eb654e59d7bfe7ee406fd7f612d765b86ba1d2a7 122024 edlib-aligner-dbgsym_1.2.4-2+b2_armhf.deb
5c6cf2e78d5351fa3e3c2e91941117e056d04ba7 20124 edlib-aligner_1.2.4-2+b2_armhf.deb
76c318c4a1f4996dd7f6317e70bc9bcc268552d0 16496 libedlib-dev_1.2.4-2+b2_armhf.deb
71c8e749f1270cbd6f05c521021f676d59ae8404 80916 libedlib0-dbgsym_1.2.4-2+b2_armhf.deb
89e846cc1d8384d62b897de8d54f09bf8f629e88 14412 libedlib0_1.2.4-2+b2_armhf.deb
e90c03bbf0ac406d3c90a97c29898f27a46c7803 8921 libedlib_1.2.4-2+b2_armhf.buildinfo
2312c2c5410fe7a5d7bdb620da4c62f8e31ace28 147756 python3-edlib-dbgsym_1.2.4-2+b2_armhf.deb
7c0bd3efada052a6fb85acec25d3932b51645bf6 27664 python3-edlib_1.2.4-2+b2_armhf.deb
Checksums-Sha256:
8ebaeabac4e4054a941804840bcd118336e755d15da3aa149a9a1c3050fa4f23 122024 edlib-aligner-dbgsym_1.2.4-2+b2_armhf.deb
eff43341f5b635dbff5f319e7375c1fd954dc2cbb2912929408c0813eb6ce4c2 20124 edlib-aligner_1.2.4-2+b2_armhf.deb
323d0e533af5d5c7ad93c385c9c0a6fca8d3c359a96eec7eb376c6b29c2def95 16496 libedlib-dev_1.2.4-2+b2_armhf.deb
f4d4224fb836f782a3fc33e6dde118db944a2943edae5e3367adaf9c8368fd9e 80916 libedlib0-dbgsym_1.2.4-2+b2_armhf.deb
6f3634dce6a4194c9f3e85dff90847228585a732d56202c944ad4881dc8db2ca 14412 libedlib0_1.2.4-2+b2_armhf.deb
169c64aabc1096b743f291ba74f34f23932d1ee8e7c02bb6cf2ea67a6b8efcb9 8921 libedlib_1.2.4-2+b2_armhf.buildinfo
30796f3d438ac562718052687989ebb9e65984cd7a0c32d358e31c2d1de0ca16 147756 python3-edlib-dbgsym_1.2.4-2+b2_armhf.deb
4372e7a7357e94e58ecbfd6349efd57f0324343773a1c26704b2169b983a1dee 27664 python3-edlib_1.2.4-2+b2_armhf.deb
Files:
be104f27b5dbb3343605d1753f6f7868 122024 debug optional edlib-aligner-dbgsym_1.2.4-2+b2_armhf.deb
029b40b59ac4b1cfb61ea8cf19063525 20124 science optional edlib-aligner_1.2.4-2+b2_armhf.deb
e2b39493f7a9e0aef9bde167b1ce1db3 16496 libdevel optional libedlib-dev_1.2.4-2+b2_armhf.deb
e7c914286d2a1dec713365438f3da4dc 80916 debug optional libedlib0-dbgsym_1.2.4-2+b2_armhf.deb
cc696beaf5c017b5c9c8898f46df5717 14412 libs optional libedlib0_1.2.4-2+b2_armhf.deb
ca645af640d33638aa92f4e79269e922 8921 science optional libedlib_1.2.4-2+b2_armhf.buildinfo
40ebf0a1ef79fa5978fb5750b4aa5d68 147756 debug optional python3-edlib-dbgsym_1.2.4-2+b2_armhf.deb
58a931ff909e9776738feb1cc9c6691d 27664 python optional python3-edlib_1.2.4-2+b2_armhf.deb
+------------------------------------------------------------------------------+
| Package contents |
+------------------------------------------------------------------------------+
edlib-aligner-dbgsym_1.2.4-2+b2_armhf.deb
-----------------------------------------
new Debian package, version 2.0.
size 122024 bytes: control archive=548 bytes.
405 bytes, 12 lines control
106 bytes, 1 lines md5sums
Package: edlib-aligner-dbgsym
Source: libedlib (1.2.4-2)
Version: 1.2.4-2+b2
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 134
Depends: edlib-aligner (= 1.2.4-2+b2)
Section: debug
Priority: optional
Description: debug symbols for edlib-aligner
Build-Ids: ead0c6d139958f4e3df1d5248eabc32906d29ec4
drwxr-xr-x root/root 0 2019-08-18 13:49 ./
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/debug/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/debug/.build-id/ea/
-rw-r--r-- root/root 126580 2019-08-18 13:49 ./usr/lib/debug/.build-id/ea/d0c6d139958f4e3df1d5248eabc32906d29ec4.debug
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/
lrwxrwxrwx root/root 0 2019-08-18 13:49 ./usr/share/doc/edlib-aligner-dbgsym -> edlib-aligner
edlib-aligner_1.2.4-2+b2_armhf.deb
----------------------------------
new Debian package, version 2.0.
size 20124 bytes: control archive=1320 bytes.
1430 bytes, 31 lines control
633 bytes, 8 lines md5sums
Package: edlib-aligner
Source: libedlib (1.2.4-2)
Version: 1.2.4-2+b2
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 57
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2), libedlib0 (= 1.2.4-2+b2)
Section: science
Priority: optional
Homepage: https://github.com/Martinsos/edlib
Description: edlib sequence alignment tool using edit distance
Edlib is a lightweight and super fast C/C++ library for sequence
alignment using edit distance. This package provides an aligner
using this library.
.
Features of libedlib
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
drwxr-xr-x root/root 0 2019-08-18 13:49 ./
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/bin/
-rwxr-xr-x root/root 38408 2019-08-18 13:49 ./usr/bin/edlib-aligner
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/edlib-aligner/
-rw-r--r-- root/root 221 2019-08-18 13:49 ./usr/share/doc/edlib-aligner/changelog.Debian.armhf.gz
-rw-r--r-- root/root 507 2019-08-18 13:49 ./usr/share/doc/edlib-aligner/changelog.Debian.gz
-rw-r--r-- root/root 1343 2019-08-18 13:49 ./usr/share/doc/edlib-aligner/copyright
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/edlib-aligner/examples/
drwxr-xr-x root/root 0 2019-01-20 19:31 ./usr/share/doc/edlib-aligner/examples/test_data/
-rw-r--r-- root/root 112 2019-01-20 19:31 ./usr/share/doc/edlib-aligner/examples/test_data/query.fasta
-rw-r--r-- root/root 111 2019-01-20 19:31 ./usr/share/doc/edlib-aligner/examples/test_data/target.fasta
-rw-r--r-- root/root 334 2019-08-18 13:49 ./usr/share/doc/edlib-aligner/run-unit-test
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/man/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/man/man1/
-rw-r--r-- root/root 815 2019-08-18 13:49 ./usr/share/man/man1/edlib-aligner.1.gz
libedlib-dev_1.2.4-2+b2_armhf.deb
---------------------------------
new Debian package, version 2.0.
size 16496 bytes: control archive=1252 bytes.
1527 bytes, 36 lines control
366 bytes, 5 lines md5sums
Package: libedlib-dev
Source: libedlib (1.2.4-2)
Version: 1.2.4-2+b2
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 52
Depends: libedlib0 (= 1.2.4-2+b2)
Section: libdevel
Priority: optional
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance (devel)
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the static library and the header files.
drwxr-xr-x root/root 0 2019-08-18 13:49 ./
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/include/
-rw-r--r-- root/root 10702 2019-01-20 19:31 ./usr/include/edlib.h
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/arm-linux-gnueabihf/
-rw-r--r-- root/root 27564 2019-08-18 13:49 ./usr/lib/arm-linux-gnueabihf/libedlib.a
lrwxrwxrwx root/root 0 2019-08-18 13:49 ./usr/lib/arm-linux-gnueabihf/libedlib.so -> libedlib.so.0
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/libedlib-dev/
-rw-r--r-- root/root 221 2019-08-18 13:49 ./usr/share/doc/libedlib-dev/changelog.Debian.armhf.gz
-rw-r--r-- root/root 507 2019-08-18 13:49 ./usr/share/doc/libedlib-dev/changelog.Debian.gz
-rw-r--r-- root/root 1343 2019-08-18 13:49 ./usr/share/doc/libedlib-dev/copyright
libedlib0-dbgsym_1.2.4-2+b2_armhf.deb
-------------------------------------
new Debian package, version 2.0.
size 80916 bytes: control archive=540 bytes.
392 bytes, 12 lines control
106 bytes, 1 lines md5sums
Package: libedlib0-dbgsym
Source: libedlib (1.2.4-2)
Version: 1.2.4-2+b2
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 92
Depends: libedlib0 (= 1.2.4-2+b2)
Section: debug
Priority: optional
Description: debug symbols for libedlib0
Build-Ids: 5101494a679043d27f329ed3df746444a964429e
drwxr-xr-x root/root 0 2019-08-18 13:49 ./
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/debug/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/debug/.build-id/51/
-rw-r--r-- root/root 83908 2019-08-18 13:49 ./usr/lib/debug/.build-id/51/01494a679043d27f329ed3df746444a964429e.debug
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/
lrwxrwxrwx root/root 0 2019-08-18 13:49 ./usr/share/doc/libedlib0-dbgsym -> libedlib0
libedlib0_1.2.4-2+b2_armhf.deb
------------------------------
new Debian package, version 2.0.
size 14412 bytes: control archive=1564 bytes.
1522 bytes, 36 lines control
310 bytes, 4 lines md5sums
32 bytes, 1 lines shlibs
729 bytes, 11 lines symbols
67 bytes, 2 lines triggers
Package: libedlib0
Source: libedlib (1.2.4-2)
Version: 1.2.4-2+b2
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 42
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2)
Section: libs
Priority: optional
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the shared library.
drwxr-xr-x root/root 0 2019-08-18 13:49 ./
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/arm-linux-gnueabihf/
lrwxrwxrwx root/root 0 2019-08-18 13:49 ./usr/lib/arm-linux-gnueabihf/libedlib.so.0 -> libedlib.so.1.2.3
-rw-r--r-- root/root 25960 2019-08-18 13:49 ./usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.3
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/libedlib0/
-rw-r--r-- root/root 221 2019-08-18 13:49 ./usr/share/doc/libedlib0/changelog.Debian.armhf.gz
-rw-r--r-- root/root 507 2019-08-18 13:49 ./usr/share/doc/libedlib0/changelog.Debian.gz
-rw-r--r-- root/root 1343 2019-08-18 13:49 ./usr/share/doc/libedlib0/copyright
python3-edlib-dbgsym_1.2.4-2+b2_armhf.deb
-----------------------------------------
new Debian package, version 2.0.
size 147756 bytes: control archive=548 bytes.
405 bytes, 12 lines control
106 bytes, 1 lines md5sums
Package: python3-edlib-dbgsym
Source: libedlib (1.2.4-2)
Version: 1.2.4-2+b2
Auto-Built-Package: debug-symbols
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 164
Depends: python3-edlib (= 1.2.4-2+b2)
Section: debug
Priority: optional
Description: debug symbols for python3-edlib
Build-Ids: e3bf1f555cf430664a25f1f71082fa8c71ac7da3
drwxr-xr-x root/root 0 2019-08-18 13:49 ./
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/debug/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/debug/.build-id/e3/
-rw-r--r-- root/root 156800 2019-08-18 13:49 ./usr/lib/debug/.build-id/e3/bf1f555cf430664a25f1f71082fa8c71ac7da3.debug
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/
lrwxrwxrwx root/root 0 2019-08-18 13:49 ./usr/share/doc/python3-edlib-dbgsym -> python3-edlib
python3-edlib_1.2.4-2+b2_armhf.deb
----------------------------------
new Debian package, version 2.0.
size 27664 bytes: control archive=1404 bytes.
1583 bytes, 36 lines control
663 bytes, 7 lines md5sums
Package: python3-edlib
Source: libedlib (1.2.4-2)
Version: 1.2.4-2+b2
Architecture: armhf
Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
Installed-Size: 79
Depends: libc6 (>= 2.4), libgcc-s1 (>= 3.5), libstdc++6 (>= 5.2), python3 (<< 3.10), python3 (>= 3.9~)
Section: python
Priority: optional
Homepage: https://github.com/Martinsos/edlib
Description: library for sequence alignment using edit distance (Python3 module)
A lightweight and super fast C/C++ library for sequence alignment using
edit distance.
.
Calculating edit distance of two strings is as simple as:
.
edlibAlign("hello", 5, "world!", 6,
edlibDefaultAlignConfig()).editDistance;
Features
.
* Calculates edit distance (Levehnstein distance).
* It can find optimal alignment path (instructions how to transform
first sequence into the second sequence).
* It can find just the start and/or end locations of alignment path -
can be useful when speed is more important than having exact
alignment path.
* Supports multiple alignment methods: global(NW), prefix(SHW) and
infix(HW), each of them useful for different scenarios.
* You can extend character equality definition, enabling you to e.g.
have wildcard characters, to have case insensitive alignment or to
work with degenerate nucleotides.
* It can easily handle small or very large sequences, even when finding
alignment path, while consuming very little memory.
* Super fast thanks to Myers's bit-vector algorithm.
.
This package contains the Python3 module.
drwxr-xr-x root/root 0 2019-08-18 13:49 ./
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/python3/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/python3/dist-packages/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/lib/python3/dist-packages/edlib-1.2.3.post1.egg-info/
-rw-r--r-- root/root 5744 2019-08-18 13:49 ./usr/lib/python3/dist-packages/edlib-1.2.3.post1.egg-info/PKG-INFO
-rw-r--r-- root/root 1 2019-08-18 13:49 ./usr/lib/python3/dist-packages/edlib-1.2.3.post1.egg-info/dependency_links.txt
-rw-r--r-- root/root 6 2019-08-18 13:49 ./usr/lib/python3/dist-packages/edlib-1.2.3.post1.egg-info/top_level.txt
-rw-r--r-- root/root 57596 2019-08-18 13:49 ./usr/lib/python3/dist-packages/edlib.cpython-39-arm-linux-gnueabihf.so
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/
drwxr-xr-x root/root 0 2019-08-18 13:49 ./usr/share/doc/python3-edlib/
-rw-r--r-- root/root 221 2019-08-18 13:49 ./usr/share/doc/python3-edlib/changelog.Debian.armhf.gz
-rw-r--r-- root/root 507 2019-08-18 13:49 ./usr/share/doc/python3-edlib/changelog.Debian.gz
-rw-r--r-- root/root 1343 2019-08-18 13:49 ./usr/share/doc/python3-edlib/copyright
+------------------------------------------------------------------------------+
| Post Build |
+------------------------------------------------------------------------------+
+------------------------------------------------------------------------------+
| Cleanup |
+------------------------------------------------------------------------------+
Purging /<<BUILDDIR>>
Not cleaning session: cloned chroot in use
+------------------------------------------------------------------------------+
| Summary |
+------------------------------------------------------------------------------+
Build Architecture: armhf
Build-Space: 19840
Build-Time: 60
Distribution: bullseye-staging
Host Architecture: armhf
Install-Time: 246
Job: libedlib_1.2.4-2
Machine Architecture: armhf
Package: libedlib
Package-Time: 324
Source-Version: 1.2.4-2
Space: 19840
Status: successful
Version: 1.2.4-2+b2
--------------------------------------------------------------------------------
Finished at 2020-12-09T10:46:12Z
Build needed 00:05:24, 19840k disk space