Raspbian Package Auto-Building

Build log for libedlib (1.2.4-1) on armhf

libedlib → 1.2.4-1 → armhf → 2019-01-31 05:43:57 

sbuild (Debian sbuild) 0.71.0 (24 Aug 2016) on bm-wb-02

+==============================================================================+
| libedlib 1.2.4-1 (armhf)                     Thu, 31 Jan 2019 05:30:42 +0000 |
+==============================================================================+

Package: libedlib
Version: 1.2.4-1
Source Version: 1.2.4-1
Distribution: buster-staging
Machine Architecture: armhf
Host Architecture: armhf
Build Architecture: armhf

I: NOTICE: Log filtering will replace 'var/lib/schroot/mount/buster-staging-armhf-sbuild-2a7d8719-aaed-444f-bfae-b9695044698c' with '<<CHROOT>>'

+------------------------------------------------------------------------------+
| Update chroot                                                                |
+------------------------------------------------------------------------------+

Get:1 http://172.17.0.1/private buster-staging InRelease [11.3 kB]
Get:2 http://172.17.0.1/private buster-staging/main Sources [11.3 MB]
Get:3 http://172.17.0.1/private buster-staging/main armhf Packages [13.0 MB]
Fetched 24.3 MB in 27s (891 kB/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges

+------------------------------------------------------------------------------+
| Fetch source files                                                           |
+------------------------------------------------------------------------------+


Check APT
---------

Checking available source versions...

Download source files with APT
------------------------------

Reading package lists...
NOTICE: 'libedlib' packaging is maintained in the 'Git' version control system at:
https://salsa.debian.org/med-team/libedlib.git
Please use:
git clone https://salsa.debian.org/med-team/libedlib.git
to retrieve the latest (possibly unreleased) updates to the package.
Need to get 4316 kB of source archives.
Get:1 http://172.17.0.1/private buster-staging/main libedlib 1.2.4-1 (dsc) [2216 B]
Get:2 http://172.17.0.1/private buster-staging/main libedlib 1.2.4-1 (tar) [4308 kB]
Get:3 http://172.17.0.1/private buster-staging/main libedlib 1.2.4-1 (diff) [5820 B]
Fetched 4316 kB in 1s (6809 kB/s)
Download complete and in download only mode
I: NOTICE: Log filtering will replace 'build/libedlib-IHB71S/libedlib-1.2.4' with '<<PKGBUILDDIR>>'
I: NOTICE: Log filtering will replace 'build/libedlib-IHB71S' with '<<BUILDDIR>>'

+------------------------------------------------------------------------------+
| Install build-essential                                                      |
+------------------------------------------------------------------------------+


Setup apt archive
-----------------

Merged Build-Depends: build-essential, fakeroot
Filtered Build-Depends: build-essential, fakeroot
dpkg-deb: building package 'sbuild-build-depends-core-dummy' in '/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive/sbuild-build-depends-core-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning:   sbuild-build-depends-core-dummy
dpkg-scanpackages: info: Wrote 1 entries to output Packages file.
gpg: keybox '/<<BUILDDIR>>/resolver-Nzqg9s/gpg/pubring.kbx' created
gpg: /<<BUILDDIR>>/resolver-Nzqg9s/gpg/trustdb.gpg: trustdb created
gpg: key 35506D9A48F77B2E: public key "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" imported
gpg: Total number processed: 1
gpg:               imported: 1
gpg: key 35506D9A48F77B2E: "Sbuild Signer (Sbuild Build Dependency Archive Key) <buildd-tools-devel@lists.alioth.debian.org>" not changed
gpg: key 35506D9A48F77B2E: secret key imported
gpg: Total number processed: 1
gpg:              unchanged: 1
gpg:       secret keys read: 1
gpg:   secret keys imported: 1
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ Release [957 B]
Get:3 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ Sources [349 B]
Get:5 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ Packages [432 B]
Fetched 2108 B in 1s (2877 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...

Install core build dependencies (apt-based resolver)
----------------------------------------------------

Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
  ca-certificates dbus dbus-user-session e2fsprogs-l10n krb5-locales libexpat1
  libgpg-error-l10n libgssapi-krb5-2 libk5crypto3 libkeyutils1 libkrb5-3
  libkrb5support0 libnss-systemd libpam-systemd libssl1.1 openssl systemd-sysv
Use 'apt autoremove' to remove them.
The following NEW packages will be installed:
  sbuild-build-depends-core-dummy
0 upgraded, 1 newly installed, 0 to remove and 0 not upgraded.
Need to get 852 B of archives.
After this operation, 0 B of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ sbuild-build-depends-core-dummy 0.invalid.0 [852 B]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 852 B in 0s (0 B/s)
Selecting previously unselected package sbuild-build-depends-core-dummy.
(Reading database ... 15817 files and directories currently installed.)
Preparing to unpack .../sbuild-build-depends-core-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-core-dummy (0.invalid.0) ...
Setting up sbuild-build-depends-core-dummy (0.invalid.0) ...
W: No sandbox user '_apt' on the system, can not drop privileges

+------------------------------------------------------------------------------+
| Check architectures                                                          |
+------------------------------------------------------------------------------+

Arch check ok (armhf included in any)

+------------------------------------------------------------------------------+
| Install package build dependencies                                           |
+------------------------------------------------------------------------------+


Setup apt archive
-----------------

Merged Build-Depends: debhelper (>= 12~), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools
Filtered Build-Depends: debhelper (>= 12~), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools
dpkg-deb: building package 'sbuild-build-depends-libedlib-dummy' in '/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive/sbuild-build-depends-libedlib-dummy.deb'.
dpkg-scanpackages: warning: Packages in archive but missing from override file:
dpkg-scanpackages: warning:   sbuild-build-depends-core-dummy sbuild-build-depends-libedlib-dummy
dpkg-scanpackages: info: Wrote 2 entries to output Packages file.
gpg: using "Sbuild Signer" as default secret key for signing
Ign:1 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ InRelease
Get:2 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ Release [963 B]
Get:3 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ Release.gpg [370 B]
Get:4 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ Sources [532 B]
Get:5 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ Packages [618 B]
Fetched 2483 B in 1s (3400 B/s)
Reading package lists...
W: No sandbox user '_apt' on the system, can not drop privileges
Reading package lists...

Install libedlib build dependencies (apt-based resolver)
--------------------------------------------------------

Installing build dependencies
Reading package lists...
Building dependency tree...
Reading state information...
The following packages were automatically installed and are no longer required:
  ca-certificates dbus dbus-user-session e2fsprogs-l10n krb5-locales
  libgpg-error-l10n libnss-systemd libpam-systemd openssl systemd-sysv
Use 'apt autoremove' to remove them.
The following additional packages will be installed:
  autoconf automake autopoint autotools-dev bsdmainutils cmake cmake-data
  cython3 d-shlibs debhelper dh-autoreconf dh-python dh-strip-nondeterminism
  dwz file gettext gettext-base groff-base intltool-debian libarchive-zip-perl
  libarchive13 libbsd0 libcroco3 libcurl4 libelf1 libexpat1-dev
  libfile-stripnondeterminism-perl libglib2.0-0 libicu63 libjsoncpp1
  libmagic-mgc libmagic1 libmpdec2 libnghttp2-14 libpipeline1 libpsl5
  libpython3-all-dev libpython3-dev libpython3-stdlib libpython3.7
  libpython3.7-dev libpython3.7-minimal libpython3.7-stdlib librhash0 librtmp1
  libsigsegv2 libssh2-1 libtool libuchardet0 libuv1 libxml2 m4 man-db
  mime-support po-debconf python3 python3-all python3-all-dev python3-dev
  python3-distutils python3-lib2to3 python3-minimal python3-pkg-resources
  python3-setuptools python3.7 python3.7-dev python3.7-minimal rename
Suggested packages:
  autoconf-archive gnu-standards autoconf-doc wamerican | wordlist whois
  vacation cmake-doc ninja-build cython-doc dh-make gettext-doc
  libasprintf-dev libgettextpo-dev groff lrzip libtool-doc gfortran
  | fortran95-compiler gcj-jdk m4-doc apparmor less www-browser
  libmail-box-perl python3-doc python3-tk python3-venv python-setuptools-doc
  python3.7-venv python3.7-doc binfmt-support
Recommended packages:
  curl | wget | lynx libarchive-cpio-perl libglib2.0-data shared-mime-info
  xdg-user-dirs publicsuffix libltdl-dev libmail-sendmail-perl
The following NEW packages will be installed:
  autoconf automake autopoint autotools-dev bsdmainutils cmake cmake-data
  cython3 d-shlibs debhelper dh-autoreconf dh-python dh-strip-nondeterminism
  dwz file gettext gettext-base groff-base intltool-debian libarchive-zip-perl
  libarchive13 libbsd0 libcroco3 libcurl4 libelf1 libexpat1-dev
  libfile-stripnondeterminism-perl libglib2.0-0 libicu63 libjsoncpp1
  libmagic-mgc libmagic1 libmpdec2 libnghttp2-14 libpipeline1 libpsl5
  libpython3-all-dev libpython3-dev libpython3-stdlib libpython3.7
  libpython3.7-dev libpython3.7-minimal libpython3.7-stdlib librhash0 librtmp1
  libsigsegv2 libssh2-1 libtool libuchardet0 libuv1 libxml2 m4 man-db
  mime-support po-debconf python3 python3-all python3-all-dev python3-dev
  python3-distutils python3-lib2to3 python3-minimal python3-pkg-resources
  python3-setuptools python3.7 python3.7-dev python3.7-minimal rename
  sbuild-build-depends-libedlib-dummy
0 upgraded, 69 newly installed, 0 to remove and 0 not upgraded.
Need to get 78.5 MB/78.5 MB of archives.
After this operation, 198 MB of additional disk space will be used.
Get:1 copy:/<<BUILDDIR>>/resolver-Nzqg9s/apt_archive ./ sbuild-build-depends-libedlib-dummy 0.invalid.0 [904 B]
Get:2 http://172.17.0.1/private buster-staging/main armhf libbsd0 armhf 0.9.1-1 [104 kB]
Get:3 http://172.17.0.1/private buster-staging/main armhf bsdmainutils armhf 11.1.2 [182 kB]
Get:4 http://172.17.0.1/private buster-staging/main armhf libuchardet0 armhf 0.0.6-3 [62.2 kB]
Get:5 http://172.17.0.1/private buster-staging/main armhf groff-base armhf 1.22.4-2 [782 kB]
Get:6 http://172.17.0.1/private buster-staging/main armhf libpipeline1 armhf 1.5.1-1 [26.6 kB]
Get:7 http://172.17.0.1/private buster-staging/main armhf man-db armhf 2.8.5-1 [1231 kB]
Get:8 http://172.17.0.1/private buster-staging/main armhf libpython3.7-minimal armhf 3.7.2-1 [582 kB]
Get:9 http://172.17.0.1/private buster-staging/main armhf python3.7-minimal armhf 3.7.2-1 [1454 kB]
Get:10 http://172.17.0.1/private buster-staging/main armhf python3-minimal armhf 3.7.2-1 [36.6 kB]
Get:11 http://172.17.0.1/private buster-staging/main armhf mime-support all 3.61 [37.1 kB]
Get:12 http://172.17.0.1/private buster-staging/main armhf libmpdec2 armhf 2.4.2-2 [67.2 kB]
Get:13 http://172.17.0.1/private buster-staging/main armhf libpython3.7-stdlib armhf 3.7.2-1 [1663 kB]
Get:14 http://172.17.0.1/private buster-staging/main armhf python3.7 armhf 3.7.2-1 [323 kB]
Get:15 http://172.17.0.1/private buster-staging/main armhf libpython3-stdlib armhf 3.7.2-1 [20.0 kB]
Get:16 http://172.17.0.1/private buster-staging/main armhf python3 armhf 3.7.2-1 [61.5 kB]
Get:17 http://172.17.0.1/private buster-staging/main armhf libmagic-mgc armhf 1:5.35-2 [242 kB]
Get:18 http://172.17.0.1/private buster-staging/main armhf libmagic1 armhf 1:5.35-2 [109 kB]
Get:19 http://172.17.0.1/private buster-staging/main armhf file armhf 1:5.35-2 [65.1 kB]
Get:20 http://172.17.0.1/private buster-staging/main armhf gettext-base armhf 0.19.8.1-9 [117 kB]
Get:21 http://172.17.0.1/private buster-staging/main armhf libsigsegv2 armhf 2.12-2 [32.3 kB]
Get:22 http://172.17.0.1/private buster-staging/main armhf m4 armhf 1.4.18-2 [185 kB]
Get:23 http://172.17.0.1/private buster-staging/main armhf autoconf all 2.69-11 [341 kB]
Get:24 http://172.17.0.1/private buster-staging/main armhf autotools-dev all 20180224.1 [77.0 kB]
Get:25 http://172.17.0.1/private buster-staging/main armhf automake all 1:1.16.1-4 [771 kB]
Get:26 http://172.17.0.1/private buster-staging/main armhf autopoint all 0.19.8.1-9 [434 kB]
Get:27 http://172.17.0.1/private buster-staging/main armhf cmake-data all 3.13.2-1 [1476 kB]
Get:28 http://172.17.0.1/private buster-staging/main armhf libicu63 armhf 63.1-6 [7973 kB]
Get:29 http://172.17.0.1/private buster-staging/main armhf libxml2 armhf 2.9.4+dfsg1-7+b1 [570 kB]
Get:30 http://172.17.0.1/private buster-staging/main armhf libarchive13 armhf 3.3.3-3 [269 kB]
Get:31 http://172.17.0.1/private buster-staging/main armhf libnghttp2-14 armhf 1.36.0-1 [73.6 kB]
Get:32 http://172.17.0.1/private buster-staging/main armhf libpsl5 armhf 0.20.2-2 [52.6 kB]
Get:33 http://172.17.0.1/private buster-staging/main armhf librtmp1 armhf 2.4+20151223.gitfa8646d.1-2 [54.0 kB]
Get:34 http://172.17.0.1/private buster-staging/main armhf libssh2-1 armhf 1.8.0-2 [125 kB]
Get:35 http://172.17.0.1/private buster-staging/main armhf libcurl4 armhf 7.63.0-1 [290 kB]
Get:36 http://172.17.0.1/private buster-staging/main armhf librhash0 armhf 1.3.7-1 [113 kB]
Get:37 http://172.17.0.1/private buster-staging/main armhf libuv1 armhf 1.24.1-1 [96.7 kB]
Get:38 http://172.17.0.1/private buster-staging/main armhf cmake armhf 3.13.2-1 [2563 kB]
Get:39 http://172.17.0.1/private buster-staging/main armhf cython3 armhf 0.29.2-2 [1299 kB]
Get:40 http://172.17.0.1/private buster-staging/main armhf d-shlibs all 0.84 [17.2 kB]
Get:41 http://172.17.0.1/private buster-staging/main armhf libtool all 2.4.6-8 [547 kB]
Get:42 http://172.17.0.1/private buster-staging/main armhf dh-autoreconf all 19 [16.9 kB]
Get:43 http://172.17.0.1/private buster-staging/main armhf libarchive-zip-perl all 1.64-1 [96.8 kB]
Get:44 http://172.17.0.1/private buster-staging/main armhf libfile-stripnondeterminism-perl all 1.1.0-1 [19.5 kB]
Get:45 http://172.17.0.1/private buster-staging/main armhf dh-strip-nondeterminism all 1.1.0-1 [12.6 kB]
Get:46 http://172.17.0.1/private buster-staging/main armhf libelf1 armhf 0.175-2 [157 kB]
Get:47 http://172.17.0.1/private buster-staging/main armhf dwz armhf 0.12-3 [66.0 kB]
Get:48 http://172.17.0.1/private buster-staging/main armhf libglib2.0-0 armhf 2.58.2-3 [1076 kB]
Get:49 http://172.17.0.1/private buster-staging/main armhf libcroco3 armhf 0.6.12-3 [132 kB]
Get:50 http://172.17.0.1/private buster-staging/main armhf gettext armhf 0.19.8.1-9 [1219 kB]
Get:51 http://172.17.0.1/private buster-staging/main armhf intltool-debian all 0.35.0+20060710.5 [26.8 kB]
Get:52 http://172.17.0.1/private buster-staging/main armhf po-debconf all 1.0.21 [248 kB]
Get:53 http://172.17.0.1/private buster-staging/main armhf debhelper all 12 [1002 kB]
Get:54 http://172.17.0.1/private buster-staging/main armhf python3-lib2to3 all 3.7.2-3 [76.7 kB]
Get:55 http://172.17.0.1/private buster-staging/main armhf python3-distutils all 3.7.2-3 [142 kB]
Get:56 http://172.17.0.1/private buster-staging/main armhf dh-python all 3.20180927 [95.8 kB]
Get:57 http://172.17.0.1/private buster-staging/main armhf libexpat1-dev armhf 2.2.6-1 [127 kB]
Get:58 http://172.17.0.1/private buster-staging/main armhf libpython3.7 armhf 3.7.2-1 [1253 kB]
Get:59 http://172.17.0.1/private buster-staging/main armhf libpython3.7-dev armhf 3.7.2-1 [47.2 MB]
Get:60 http://172.17.0.1/private buster-staging/main armhf libpython3-dev armhf 3.7.2-1 [20.1 kB]
Get:61 http://172.17.0.1/private buster-staging/main armhf libpython3-all-dev armhf 3.7.2-1 [1064 B]
Get:62 http://172.17.0.1/private buster-staging/main armhf python3-all armhf 3.7.2-1 [1060 B]
Get:63 http://172.17.0.1/private buster-staging/main armhf python3.7-dev armhf 3.7.2-1 [510 kB]
Get:64 http://172.17.0.1/private buster-staging/main armhf python3-dev armhf 3.7.2-1 [1260 B]
Get:65 http://172.17.0.1/private buster-staging/main armhf python3-all-dev armhf 3.7.2-1 [1060 B]
Get:66 http://172.17.0.1/private buster-staging/main armhf python3-pkg-resources all 40.6.3-1 [152 kB]
Get:67 http://172.17.0.1/private buster-staging/main armhf python3-setuptools all 40.6.3-1 [303 kB]
Get:68 http://172.17.0.1/private buster-staging/main armhf rename all 1.10-1 [17.2 kB]
debconf: delaying package configuration, since apt-utils is not installed
Fetched 78.5 MB in 8s (9804 kB/s)
Selecting previously unselected package libbsd0:armhf.
(Reading database ... 15817 files and directories currently installed.)
Preparing to unpack .../0-libbsd0_0.9.1-1_armhf.deb ...
Unpacking libbsd0:armhf (0.9.1-1) ...
Selecting previously unselected package bsdmainutils.
Preparing to unpack .../1-bsdmainutils_11.1.2_armhf.deb ...
Unpacking bsdmainutils (11.1.2) ...
Selecting previously unselected package libuchardet0:armhf.
Preparing to unpack .../2-libuchardet0_0.0.6-3_armhf.deb ...
Unpacking libuchardet0:armhf (0.0.6-3) ...
Selecting previously unselected package groff-base.
Preparing to unpack .../3-groff-base_1.22.4-2_armhf.deb ...
Unpacking groff-base (1.22.4-2) ...
Selecting previously unselected package libpipeline1:armhf.
Preparing to unpack .../4-libpipeline1_1.5.1-1_armhf.deb ...
Unpacking libpipeline1:armhf (1.5.1-1) ...
Selecting previously unselected package man-db.
Preparing to unpack .../5-man-db_2.8.5-1_armhf.deb ...
Unpacking man-db (2.8.5-1) ...
Selecting previously unselected package libpython3.7-minimal:armhf.
Preparing to unpack .../6-libpython3.7-minimal_3.7.2-1_armhf.deb ...
Unpacking libpython3.7-minimal:armhf (3.7.2-1) ...
Selecting previously unselected package python3.7-minimal.
Preparing to unpack .../7-python3.7-minimal_3.7.2-1_armhf.deb ...
Unpacking python3.7-minimal (3.7.2-1) ...
Setting up libpython3.7-minimal:armhf (3.7.2-1) ...
Setting up python3.7-minimal (3.7.2-1) ...
Selecting previously unselected package python3-minimal.
(Reading database ... 16691 files and directories currently installed.)
Preparing to unpack .../0-python3-minimal_3.7.2-1_armhf.deb ...
Unpacking python3-minimal (3.7.2-1) ...
Selecting previously unselected package mime-support.
Preparing to unpack .../1-mime-support_3.61_all.deb ...
Unpacking mime-support (3.61) ...
Selecting previously unselected package libmpdec2:armhf.
Preparing to unpack .../2-libmpdec2_2.4.2-2_armhf.deb ...
Unpacking libmpdec2:armhf (2.4.2-2) ...
Selecting previously unselected package libpython3.7-stdlib:armhf.
Preparing to unpack .../3-libpython3.7-stdlib_3.7.2-1_armhf.deb ...
Unpacking libpython3.7-stdlib:armhf (3.7.2-1) ...
Selecting previously unselected package python3.7.
Preparing to unpack .../4-python3.7_3.7.2-1_armhf.deb ...
Unpacking python3.7 (3.7.2-1) ...
Selecting previously unselected package libpython3-stdlib:armhf.
Preparing to unpack .../5-libpython3-stdlib_3.7.2-1_armhf.deb ...
Unpacking libpython3-stdlib:armhf (3.7.2-1) ...
Setting up python3-minimal (3.7.2-1) ...
Selecting previously unselected package python3.
(Reading database ... 17123 files and directories currently installed.)
Preparing to unpack .../00-python3_3.7.2-1_armhf.deb ...
Unpacking python3 (3.7.2-1) ...
Selecting previously unselected package libmagic-mgc.
Preparing to unpack .../01-libmagic-mgc_1%3a5.35-2_armhf.deb ...
Unpacking libmagic-mgc (1:5.35-2) ...
Selecting previously unselected package libmagic1:armhf.
Preparing to unpack .../02-libmagic1_1%3a5.35-2_armhf.deb ...
Unpacking libmagic1:armhf (1:5.35-2) ...
Selecting previously unselected package file.
Preparing to unpack .../03-file_1%3a5.35-2_armhf.deb ...
Unpacking file (1:5.35-2) ...
Selecting previously unselected package gettext-base.
Preparing to unpack .../04-gettext-base_0.19.8.1-9_armhf.deb ...
Unpacking gettext-base (0.19.8.1-9) ...
Selecting previously unselected package libsigsegv2:armhf.
Preparing to unpack .../05-libsigsegv2_2.12-2_armhf.deb ...
Unpacking libsigsegv2:armhf (2.12-2) ...
Selecting previously unselected package m4.
Preparing to unpack .../06-m4_1.4.18-2_armhf.deb ...
Unpacking m4 (1.4.18-2) ...
Selecting previously unselected package autoconf.
Preparing to unpack .../07-autoconf_2.69-11_all.deb ...
Unpacking autoconf (2.69-11) ...
Selecting previously unselected package autotools-dev.
Preparing to unpack .../08-autotools-dev_20180224.1_all.deb ...
Unpacking autotools-dev (20180224.1) ...
Selecting previously unselected package automake.
Preparing to unpack .../09-automake_1%3a1.16.1-4_all.deb ...
Unpacking automake (1:1.16.1-4) ...
Selecting previously unselected package autopoint.
Preparing to unpack .../10-autopoint_0.19.8.1-9_all.deb ...
Unpacking autopoint (0.19.8.1-9) ...
Selecting previously unselected package cmake-data.
Preparing to unpack .../11-cmake-data_3.13.2-1_all.deb ...
Unpacking cmake-data (3.13.2-1) ...
Selecting previously unselected package libicu63:armhf.
Preparing to unpack .../12-libicu63_63.1-6_armhf.deb ...
Unpacking libicu63:armhf (63.1-6) ...
Selecting previously unselected package libxml2:armhf.
Preparing to unpack .../13-libxml2_2.9.4+dfsg1-7+b1_armhf.deb ...
Unpacking libxml2:armhf (2.9.4+dfsg1-7+b1) ...
Selecting previously unselected package libarchive13:armhf.
Preparing to unpack .../14-libarchive13_3.3.3-3_armhf.deb ...
Unpacking libarchive13:armhf (3.3.3-3) ...
Selecting previously unselected package libnghttp2-14:armhf.
Preparing to unpack .../15-libnghttp2-14_1.36.0-1_armhf.deb ...
Unpacking libnghttp2-14:armhf (1.36.0-1) ...
Selecting previously unselected package libpsl5:armhf.
Preparing to unpack .../16-libpsl5_0.20.2-2_armhf.deb ...
Unpacking libpsl5:armhf (0.20.2-2) ...
Selecting previously unselected package librtmp1:armhf.
Preparing to unpack .../17-librtmp1_2.4+20151223.gitfa8646d.1-2_armhf.deb ...
Unpacking librtmp1:armhf (2.4+20151223.gitfa8646d.1-2) ...
Selecting previously unselected package libssh2-1:armhf.
Preparing to unpack .../18-libssh2-1_1.8.0-2_armhf.deb ...
Unpacking libssh2-1:armhf (1.8.0-2) ...
Selecting previously unselected package libcurl4:armhf.
Preparing to unpack .../19-libcurl4_7.63.0-1_armhf.deb ...
Unpacking libcurl4:armhf (7.63.0-1) ...
Selecting previously unselected package libjsoncpp1:armhf.
Preparing to unpack .../20-libjsoncpp1_1.7.4-3_armhf.deb ...
Unpacking libjsoncpp1:armhf (1.7.4-3) ...
Selecting previously unselected package librhash0:armhf.
Preparing to unpack .../21-librhash0_1.3.7-1_armhf.deb ...
Unpacking librhash0:armhf (1.3.7-1) ...
Selecting previously unselected package libuv1:armhf.
Preparing to unpack .../22-libuv1_1.24.1-1_armhf.deb ...
Unpacking libuv1:armhf (1.24.1-1) ...
Selecting previously unselected package cmake.
Preparing to unpack .../23-cmake_3.13.2-1_armhf.deb ...
Unpacking cmake (3.13.2-1) ...
Selecting previously unselected package cython3.
Preparing to unpack .../24-cython3_0.29.2-2_armhf.deb ...
Unpacking cython3 (0.29.2-2) ...
Selecting previously unselected package d-shlibs.
Preparing to unpack .../25-d-shlibs_0.84_all.deb ...
Unpacking d-shlibs (0.84) ...
Selecting previously unselected package libtool.
Preparing to unpack .../26-libtool_2.4.6-8_all.deb ...
Unpacking libtool (2.4.6-8) ...
Selecting previously unselected package dh-autoreconf.
Preparing to unpack .../27-dh-autoreconf_19_all.deb ...
Unpacking dh-autoreconf (19) ...
Selecting previously unselected package libarchive-zip-perl.
Preparing to unpack .../28-libarchive-zip-perl_1.64-1_all.deb ...
Unpacking libarchive-zip-perl (1.64-1) ...
Selecting previously unselected package libfile-stripnondeterminism-perl.
Preparing to unpack .../29-libfile-stripnondeterminism-perl_1.1.0-1_all.deb ...
Unpacking libfile-stripnondeterminism-perl (1.1.0-1) ...
Selecting previously unselected package dh-strip-nondeterminism.
Preparing to unpack .../30-dh-strip-nondeterminism_1.1.0-1_all.deb ...
Unpacking dh-strip-nondeterminism (1.1.0-1) ...
Selecting previously unselected package libelf1:armhf.
Preparing to unpack .../31-libelf1_0.175-2_armhf.deb ...
Unpacking libelf1:armhf (0.175-2) ...
Selecting previously unselected package dwz.
Preparing to unpack .../32-dwz_0.12-3_armhf.deb ...
Unpacking dwz (0.12-3) ...
Selecting previously unselected package libglib2.0-0:armhf.
Preparing to unpack .../33-libglib2.0-0_2.58.2-3_armhf.deb ...
Unpacking libglib2.0-0:armhf (2.58.2-3) ...
Selecting previously unselected package libcroco3:armhf.
Preparing to unpack .../34-libcroco3_0.6.12-3_armhf.deb ...
Unpacking libcroco3:armhf (0.6.12-3) ...
Selecting previously unselected package gettext.
Preparing to unpack .../35-gettext_0.19.8.1-9_armhf.deb ...
Unpacking gettext (0.19.8.1-9) ...
Selecting previously unselected package intltool-debian.
Preparing to unpack .../36-intltool-debian_0.35.0+20060710.5_all.deb ...
Unpacking intltool-debian (0.35.0+20060710.5) ...
Selecting previously unselected package po-debconf.
Preparing to unpack .../37-po-debconf_1.0.21_all.deb ...
Unpacking po-debconf (1.0.21) ...
Selecting previously unselected package debhelper.
Preparing to unpack .../38-debhelper_12_all.deb ...
Unpacking debhelper (12) ...
Selecting previously unselected package python3-lib2to3.
Preparing to unpack .../39-python3-lib2to3_3.7.2-3_all.deb ...
Unpacking python3-lib2to3 (3.7.2-3) ...
Selecting previously unselected package python3-distutils.
Preparing to unpack .../40-python3-distutils_3.7.2-3_all.deb ...
Unpacking python3-distutils (3.7.2-3) ...
Selecting previously unselected package dh-python.
Preparing to unpack .../41-dh-python_3.20180927_all.deb ...
Unpacking dh-python (3.20180927) ...
Selecting previously unselected package libexpat1-dev:armhf.
Preparing to unpack .../42-libexpat1-dev_2.2.6-1_armhf.deb ...
Unpacking libexpat1-dev:armhf (2.2.6-1) ...
Selecting previously unselected package libpython3.7:armhf.
Preparing to unpack .../43-libpython3.7_3.7.2-1_armhf.deb ...
Unpacking libpython3.7:armhf (3.7.2-1) ...
Selecting previously unselected package libpython3.7-dev:armhf.
Preparing to unpack .../44-libpython3.7-dev_3.7.2-1_armhf.deb ...
Unpacking libpython3.7-dev:armhf (3.7.2-1) ...
Selecting previously unselected package libpython3-dev:armhf.
Preparing to unpack .../45-libpython3-dev_3.7.2-1_armhf.deb ...
Unpacking libpython3-dev:armhf (3.7.2-1) ...
Selecting previously unselected package libpython3-all-dev:armhf.
Preparing to unpack .../46-libpython3-all-dev_3.7.2-1_armhf.deb ...
Unpacking libpython3-all-dev:armhf (3.7.2-1) ...
Selecting previously unselected package python3-all.
Preparing to unpack .../47-python3-all_3.7.2-1_armhf.deb ...
Unpacking python3-all (3.7.2-1) ...
Selecting previously unselected package python3.7-dev.
Preparing to unpack .../48-python3.7-dev_3.7.2-1_armhf.deb ...
Unpacking python3.7-dev (3.7.2-1) ...
Selecting previously unselected package python3-dev.
Preparing to unpack .../49-python3-dev_3.7.2-1_armhf.deb ...
Unpacking python3-dev (3.7.2-1) ...
Selecting previously unselected package python3-all-dev.
Preparing to unpack .../50-python3-all-dev_3.7.2-1_armhf.deb ...
Unpacking python3-all-dev (3.7.2-1) ...
Selecting previously unselected package python3-pkg-resources.
Preparing to unpack .../51-python3-pkg-resources_40.6.3-1_all.deb ...
Unpacking python3-pkg-resources (40.6.3-1) ...
Selecting previously unselected package python3-setuptools.
Preparing to unpack .../52-python3-setuptools_40.6.3-1_all.deb ...
Unpacking python3-setuptools (40.6.3-1) ...
Selecting previously unselected package rename.
Preparing to unpack .../53-rename_1.10-1_all.deb ...
Unpacking rename (1.10-1) ...
Selecting previously unselected package sbuild-build-depends-libedlib-dummy.
Preparing to unpack .../54-sbuild-build-depends-libedlib-dummy_0.invalid.0_armhf.deb ...
Unpacking sbuild-build-depends-libedlib-dummy (0.invalid.0) ...
Setting up libarchive-zip-perl (1.64-1) ...
Setting up libnghttp2-14:armhf (1.36.0-1) ...
Setting up mime-support (3.61) ...
Installing new version of config file /etc/mime.types ...
Setting up libicu63:armhf (63.1-6) ...
Setting up libsigsegv2:armhf (2.12-2) ...
Setting up rename (1.10-1) ...
update-alternatives: using /usr/bin/file-rename to provide /usr/bin/rename (rename) in auto mode
Setting up libuv1:armhf (1.24.1-1) ...
Setting up libpsl5:armhf (0.20.2-2) ...
Setting up libelf1:armhf (0.175-2) ...
Setting up libglib2.0-0:armhf (2.58.2-3) ...
No schema files found: removed existing output file.
Setting up d-shlibs (0.84) ...
Setting up gettext-base (0.19.8.1-9) ...
Setting up cmake-data (3.13.2-1) ...
Setting up libpipeline1:armhf (1.5.1-1) ...
Setting up librtmp1:armhf (2.4+20151223.gitfa8646d.1-2) ...
Setting up m4 (1.4.18-2) ...
Setting up libbsd0:armhf (0.9.1-1) ...
Setting up libxml2:armhf (2.9.4+dfsg1-7+b1) ...
Setting up libuchardet0:armhf (0.0.6-3) ...
Setting up libmagic-mgc (1:5.35-2) ...
Setting up libmagic1:armhf (1:5.35-2) ...
Setting up librhash0:armhf (1.3.7-1) ...
Setting up libcroco3:armhf (0.6.12-3) ...
Setting up libssh2-1:armhf (1.8.0-2) ...
Processing triggers for libc-bin (2.28-5+rpi1) ...
Setting up dwz (0.12-3) ...
Setting up autotools-dev (20180224.1) ...
Setting up libexpat1-dev:armhf (2.2.6-1) ...
Setting up bsdmainutils (11.1.2) ...
update-alternatives: using /usr/bin/bsd-write to provide /usr/bin/write (write) in auto mode
update-alternatives: using /usr/bin/bsd-from to provide /usr/bin/from (from) in auto mode
Setting up autopoint (0.19.8.1-9) ...
Setting up libmpdec2:armhf (2.4.2-2) ...
Setting up libfile-stripnondeterminism-perl (1.1.0-1) ...
Setting up libjsoncpp1:armhf (1.7.4-3) ...
Setting up libpython3.7-stdlib:armhf (3.7.2-1) ...
Setting up gettext (0.19.8.1-9) ...
Setting up libarchive13:armhf (3.3.3-3) ...
Setting up groff-base (1.22.4-2) ...
Setting up libcurl4:armhf (7.63.0-1) ...
Setting up python3.7 (3.7.2-1) ...
Setting up autoconf (2.69-11) ...
Setting up file (1:5.35-2) ...
Setting up intltool-debian (0.35.0+20060710.5) ...
Setting up libpython3.7:armhf (3.7.2-1) ...
Setting up automake (1:1.16.1-4) ...
update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode
Setting up libpython3.7-dev:armhf (3.7.2-1) ...
Setting up man-db (2.8.5-1) ...
Not building database; man-db/auto-update is not 'true'.
Created symlink /etc/systemd/system/timers.target.wants/man-db.timer -> /lib/systemd/system/man-db.timer.
Setting up cmake (3.13.2-1) ...
Setting up libpython3-dev:armhf (3.7.2-1) ...
Setting up libtool (2.4.6-8) ...
Setting up libpython3-stdlib:armhf (3.7.2-1) ...
Setting up po-debconf (1.0.21) ...
Setting up python3 (3.7.2-1) ...
Setting up python3-pkg-resources (40.6.3-1) ...
Setting up python3.7-dev (3.7.2-1) ...
Setting up libpython3-all-dev:armhf (3.7.2-1) ...
Setting up cython3 (0.29.2-2) ...
Setting up python3-lib2to3 (3.7.2-3) ...
Setting up python3-distutils (3.7.2-3) ...
Setting up python3-setuptools (40.6.3-1) ...
Setting up dh-python (3.20180927) ...
Setting up python3-dev (3.7.2-1) ...
Setting up python3-all (3.7.2-1) ...
Setting up python3-all-dev (3.7.2-1) ...
Setting up dh-autoreconf (19) ...
Setting up dh-strip-nondeterminism (1.1.0-1) ...
Setting up debhelper (12) ...
Setting up sbuild-build-depends-libedlib-dummy (0.invalid.0) ...
Processing triggers for libc-bin (2.28-5+rpi1) ...
W: No sandbox user '_apt' on the system, can not drop privileges

+------------------------------------------------------------------------------+
| Build environment                                                            |
+------------------------------------------------------------------------------+

Kernel: Linux 4.9.0-0.bpo.6-armmp armhf (armv7l)
Toolchain package versions: binutils_2.31.1-11+rpi1 dpkg-dev_1.19.2 g++-8_8.2.0-14+rpi1 gcc-8_8.2.0-14+rpi1 libc6-dev_2.28-5+rpi1 libstdc++-8-dev_8.2.0-14+rpi1 libstdc++6_8.2.0-14+rpi1 linux-libc-dev_4.18.20-2+rpi1
Package versions: adduser_3.118 apt_1.8.0~beta1 autoconf_2.69-11 automake_1:1.16.1-4 autopoint_0.19.8.1-9 autotools-dev_20180224.1 base-files_10.1+rpi1 base-passwd_3.5.45 bash_5.0-2 binutils_2.31.1-11+rpi1 binutils-arm-linux-gnueabihf_2.31.1-11+rpi1 binutils-common_2.31.1-11+rpi1 bsdmainutils_11.1.2 bsdutils_1:2.33.1-0.1 build-essential_12.5 bzip2_1.0.6-9 ca-certificates_20170717 cmake_3.13.2-1 cmake-data_3.13.2-1 coreutils_8.30-1 cpio_2.12+dfsg-6 cpp_4:8.2.0-2+rpi1 cpp-8_8.2.0-14+rpi1 cython3_0.29.2-2 d-shlibs_0.84 dash_0.5.10.2-5 dbus_1.12.12-1 dbus-user-session_1.12.12-1 debconf_1.5.70 debhelper_12 debianutils_4.8.6.1 dh-autoreconf_19 dh-python_3.20180927 dh-strip-nondeterminism_1.1.0-1 diffutils_1:3.6-1 dirmngr_2.2.12-1+rpi1 dmsetup_2:1.02.155-1 dpkg_1.19.2 dpkg-dev_1.19.2 dwz_0.12-3 e2fslibs_1.44.5-1 e2fsprogs_1.44.5-1 e2fsprogs-l10n_1.44.5-1 fakeroot_1.23-1 fdisk_2.33.1-0.1 file_1:5.35-2 findutils_4.6.0+git+20190105-2 g++_4:8.2.0-2+rpi1 g++-8_8.2.0-14+rpi1 gcc_4:8.2.0-2+rpi1 gcc-4.6-base_4.6.4-5+rpi1 gcc-4.7-base_4.7.3-11+rpi1 gcc-4.8-base_4.8.5-4 gcc-4.9-base_4.9.4-2+rpi1+b19 gcc-5-base_5.5.0-8 gcc-8_8.2.0-14+rpi1 gcc-8-base_8.2.0-14+rpi1 gettext_0.19.8.1-9 gettext-base_0.19.8.1-9 gnupg_2.2.12-1+rpi1 gnupg-agent_2.2.12-1+rpi1 gnupg-l10n_2.2.12-1+rpi1 gnupg-utils_2.2.12-1+rpi1 gpg_2.2.12-1+rpi1 gpg-agent_2.2.12-1+rpi1 gpg-wks-client_2.2.12-1+rpi1 gpg-wks-server_2.2.12-1+rpi1 gpgconf_2.2.12-1+rpi1 gpgsm_2.2.12-1+rpi1 gpgv_2.2.12-1+rpi1 grep_3.3-1 groff-base_1.22.4-2 gzip_1.9-3 hostname_3.21 inetutils-ping_2:1.9.4-5 init-system-helpers_1.56+nmu1 initramfs-tools_0.132 initramfs-tools-core_0.132 intltool-debian_0.35.0+20060710.5 klibc-utils_2.0.4-15+rpi1 kmod_25-2 krb5-locales_1.17-1 libacl1_2.2.52-3 libapparmor1_2.13.2-3 libapt-pkg5.0_1.8.0~beta1 libarchive-zip-perl_1.64-1 libarchive13_3.3.3-3 libargon2-1_0~20171227-0.1 libasan5_8.2.0-14+rpi1 libassuan0_2.5.2-1 libatomic1_8.2.0-14+rpi1 libattr1_1:2.4.47-2 libaudit-common_1:2.8.4-2 libaudit1_1:2.8.4-2+b1 libbinutils_2.31.1-11+rpi1 libblkid1_2.33.1-0.1 libbsd0_0.9.1-1 libbz2-1.0_1.0.6-9 libc-bin_2.28-5+rpi1 libc-dev-bin_2.28-5+rpi1 libc6_2.28-5+rpi1 libc6-dev_2.28-5+rpi1 libcap-ng0_0.7.9-2 libcap2_1:2.25-1.2 libcc1-0_8.2.0-14+rpi1 libcom-err2_1.44.5-1 libcroco3_0.6.12-3 libcryptsetup12_2:2.0.6-1 libcryptsetup4_2:1.7.5-1 libcurl4_7.63.0-1 libdb5.3_5.3.28+dfsg1-0.2 libdbus-1-3_1.12.12-1 libdebconfclient0_0.246 libdevmapper1.02.1_2:1.02.155-1 libdpkg-perl_1.19.2 libdrm-common_2.4.95-1+rpi1 libdrm2_2.4.95-1+rpi1 libelf1_0.175-2 libexpat1_2.2.6-1 libexpat1-dev_2.2.6-1 libext2fs2_1.44.5-1 libfakeroot_1.23-1 libfdisk1_2.33.1-0.1 libffi6_3.2.1-9 libfile-stripnondeterminism-perl_1.1.0-1 libgcc-8-dev_8.2.0-14+rpi1 libgcc1_1:8.2.0-14+rpi1 libgcrypt20_1.8.4-4 libgdbm-compat4_1.18.1-2 libgdbm3_1.8.3-14 libgdbm6_1.18.1-2 libglib2.0-0_2.58.2-3 libgmp10_2:6.1.2+dfsg-4 libgnutls30_3.6.5-2+rpi1 libgomp1_8.2.0-14+rpi1 libgpg-error-l10n_1.33-3 libgpg-error0_1.33-3 libgssapi-krb5-2_1.17-1 libhogweed4_3.4.1~rc1-1 libicu63_63.1-6 libidn11_1.33-2.2 libidn2-0_2.0.5-1 libip4tc0_1.8.2-3 libisl19_0.20-2 libjson-c3_0.12.1-1.3 libjsoncpp1_1.7.4-3 libk5crypto3_1.17-1 libkeyutils1_1.5.9-9.3 libklibc_2.0.4-15+rpi1 libkmod2_25-2 libkrb5-3_1.17-1 libkrb5support0_1.17-1 libksba8_1.3.5-2 libldap-2.4-2_2.4.47+dfsg-2 libldap-common_2.4.47+dfsg-2 liblz4-1_1.8.3-1 liblzma5_5.2.2-1.3 libmagic-mgc_1:5.35-2 libmagic1_1:5.35-2 libmount1_2.33.1-0.1 libmpc3_1.1.0-1 libmpdec2_2.4.2-2 libmpfr6_4.0.2~rc1-1 libncurses5_6.1+20181013-1 libncurses6_6.1+20181013-1 libncursesw5_6.1+20181013-1 libncursesw6_6.1+20181013-1 libnettle6_3.4.1~rc1-1 libnghttp2-14_1.36.0-1 libnpth0_1.6-1 libnss-systemd_240-4+rpi1 libp11-kit0_0.23.14-2 libpam-modules_1.1.8-4 libpam-modules-bin_1.1.8-4 libpam-runtime_1.1.8-4 libpam-systemd_240-4+rpi1 libpam0g_1.1.8-4 libpcre3_2:8.39-11+rpi1 libperl5.24_5.24.1-7 libperl5.28_5.28.1-3 libpipeline1_1.5.1-1 libplymouth4_0.9.4-1 libpng16-16_1.6.36-2 libprocps7_2:3.3.15-2 libpsl5_0.20.2-2 libpython3-all-dev_3.7.2-1 libpython3-dev_3.7.2-1 libpython3-stdlib_3.7.2-1 libpython3.7_3.7.2-1 libpython3.7-dev_3.7.2-1 libpython3.7-minimal_3.7.2-1 libpython3.7-stdlib_3.7.2-1 libreadline7_7.0-5 librhash0_1.3.7-1 librtmp1_2.4+20151223.gitfa8646d.1-2 libsasl2-2_2.1.27+dfsg-1 libsasl2-modules-db_2.1.27+dfsg-1 libseccomp2_2.3.3-3+b1 libselinux1_2.8-1+b1 libsemanage-common_2.8-2 libsemanage1_2.8-2 libsepol1_2.8-1 libsigsegv2_2.12-2 libsmartcols1_2.33.1-0.1 libsqlite3-0_3.26.0+fossilbc891ac6b-1 libss2_1.44.5-1 libssh2-1_1.8.0-2 libssl1.1_1.1.1a-1 libstdc++-8-dev_8.2.0-14+rpi1 libstdc++6_8.2.0-14+rpi1 libsystemd0_240-4+rpi1 libtasn1-6_4.13-3 libtinfo5_6.1+20181013-1 libtinfo6_6.1+20181013-1 libtool_2.4.6-8 libubsan1_8.2.0-14+rpi1 libuchardet0_0.0.6-3 libudev1_240-4+rpi1 libunistring2_0.9.10-1 libustr-1.0-1_1.0.4-6 libuuid1_2.33.1-0.1 libuv1_1.24.1-1 libxml2_2.9.4+dfsg1-7+b1 libzstd1_1.3.8+dfsg-3+rpi1 linux-base_4.5 linux-libc-dev_4.18.20-2+rpi1 login_1:4.5-1.1 lsb-base_10.2018112800+rpi1 m4_1.4.18-2 make_4.2.1-1.2 makedev_2.3.1-94 man-db_2.8.5-1 mawk_1.3.3-17 mime-support_3.61 mount_2.33.1-0.1 multiarch-support_2.28-5+rpi1 nano_3.2-1 ncurses-base_6.1+20181013-1 ncurses-bin_6.1+20181013-1 netbase_5.5 openssl_1.1.1a-1 passwd_1:4.5-1.1 patch_2.7.6-3 perl_5.28.1-3 perl-base_5.28.1-3 perl-modules-5.24_5.24.1-7 perl-modules-5.28_5.28.1-3 pinentry-curses_1.1.0-1 plymouth_0.9.4-1 po-debconf_1.0.21 procps_2:3.3.15-2 python3_3.7.2-1 python3-all_3.7.2-1 python3-all-dev_3.7.2-1 python3-dev_3.7.2-1 python3-distutils_3.7.2-3 python3-lib2to3_3.7.2-3 python3-minimal_3.7.2-1 python3-pkg-resources_40.6.3-1 python3-setuptools_40.6.3-1 python3.7_3.7.2-1 python3.7-dev_3.7.2-1 python3.7-minimal_3.7.2-1 raspbian-archive-keyring_20120528.2 readline-common_7.0-5 rename_1.10-1 sbuild-build-depends-core-dummy_0.invalid.0 sbuild-build-depends-libedlib-dummy_0.invalid.0 sed_4.7-1 sensible-utils_0.0.12 systemd_240-4+rpi1 systemd-sysv_240-4+rpi1 sysvinit-utils_2.93-5 tar_1.30+dfsg-4 tzdata_2018i-1 udev_240-4+rpi1 util-linux_2.33.1-0.1 xz-utils_5.2.2-1.3 zlib1g_1:1.2.11.dfsg-1

+------------------------------------------------------------------------------+
| Build                                                                        |
+------------------------------------------------------------------------------+


Unpack source
-------------

gpgv: unknown type of key resource 'trustedkeys.kbx'
gpgv: keyblock resource '/sbuild-nonexistent/.gnupg/trustedkeys.kbx': General error
gpgv: Signature made Mon Jan 28 18:12:49 2019 UTC
gpgv:                using RSA key F1F007320A035541F0A663CA578A0494D1C646D1
gpgv:                issuer "tille@debian.org"
gpgv: Can't check signature: No public key
dpkg-source: warning: failed to verify signature on ./libedlib_1.2.4-1.dsc
dpkg-source: info: extracting libedlib in /<<PKGBUILDDIR>>
dpkg-source: info: unpacking libedlib_1.2.4.orig.tar.gz
dpkg-source: info: unpacking libedlib_1.2.4-1.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying soversion.patch
dpkg-source: info: applying do_not_build_hello_example.patch
dpkg-source: info: applying cython3.patch

Check disc space
----------------

Sufficient free space for build

User Environment
----------------

APT_CONFIG=/var/lib/sbuild/apt.conf
DEB_BUILD_OPTIONS=parallel=4
HOME=/sbuild-nonexistent
LC_ALL=POSIX
LOGNAME=buildd
PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games
SCHROOT_ALIAS_NAME=buster-staging-armhf-sbuild
SCHROOT_CHROOT_NAME=buster-staging-armhf-sbuild
SCHROOT_COMMAND=env
SCHROOT_GID=109
SCHROOT_GROUP=buildd
SCHROOT_SESSION_ID=buster-staging-armhf-sbuild-2a7d8719-aaed-444f-bfae-b9695044698c
SCHROOT_UID=104
SCHROOT_USER=buildd
SHELL=/bin/sh
TERM=linux
USER=buildd

dpkg-buildpackage
-----------------

dpkg-buildpackage: info: source package libedlib
dpkg-buildpackage: info: source version 1.2.4-1
dpkg-buildpackage: info: source distribution unstable
 dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
 fakeroot debian/rules clean
dh clean --with python3
   dh_clean
 debian/rules build-arch
dh build-arch --with python3
   dh_update_autotools_config -a
   dh_autoreconf -a
   debian/rules override_dh_auto_configure
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_configure --buildsystem=cmake -- -DCMAKE_BUILD_TYPE=Release
	cd obj-arm-linux-gnueabihf && cmake -DCMAKE_INSTALL_PREFIX=/usr -DCMAKE_BUILD_TYPE=None -DCMAKE_INSTALL_SYSCONFDIR=/etc -DCMAKE_INSTALL_LOCALSTATEDIR=/var -DCMAKE_EXPORT_NO_PACKAGE_REGISTRY=ON -DCMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY=ON -DCMAKE_INSTALL_RUNSTATEDIR=/run "-GUnix Makefiles" -DCMAKE_VERBOSE_MAKEFILE=ON -DCMAKE_INSTALL_LIBDIR=lib/arm-linux-gnueabihf -DCMAKE_BUILD_TYPE=Release ..
-- The CXX compiler identification is GNU 8.2.0
-- Check for working CXX compiler: /usr/bin/c++
-- Check for working CXX compiler: /usr/bin/c++ -- works
-- Detecting CXX compiler ABI info
-- Detecting CXX compiler ABI info - done
-- Detecting CXX compile features
-- Detecting CXX compile features - done
Setting warning flags
-- Configuring done
-- Generating done
CMake Warning:
  Manually-specified variables were not used by the project:

    CMAKE_EXPORT_NO_PACKAGE_REGISTRY
    CMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY
    CMAKE_INSTALL_LIBDIR
    CMAKE_INSTALL_LOCALSTATEDIR
    CMAKE_INSTALL_RUNSTATEDIR
    CMAKE_INSTALL_SYSCONFDIR


-- Build files have been written to: /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   debian/rules override_dh_auto_build
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_build --buildsystem=cmake
	cd obj-arm-linux-gnueabihf && make -j4 "INSTALL=install --strip-program=true"
make[2]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -S/<<PKGBUILDDIR>> -B/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/progress.marks
make -f CMakeFiles/Makefile2 all
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake --color=
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake --color=
Scanning dependencies of target edlib_static
Scanning dependencies of target edlib
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 12%] Building CXX object CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o
/usr/bin/c++  -Dedlib_EXPORTS -I/<<PKGBUILDDIR>>/edlib/include  -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -fPIC   -std=c++11 -o CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -c /<<PKGBUILDDIR>>/edlib/src/edlib.cpp
[ 25%] Building CXX object CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o
/usr/bin/c++   -I/<<PKGBUILDDIR>>/edlib/include  -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG   -std=c++11 -o CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -c /<<PKGBUILDDIR>>/edlib/src/edlib.cpp
[ 37%] Linking CXX static library lib/libedlib_static.a
/usr/bin/cmake -P CMakeFiles/edlib_static.dir/cmake_clean_target.cmake
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib_static.dir/link.txt --verbose=1
/usr/bin/ar qc lib/libedlib_static.a  CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o
/usr/bin/ranlib lib/libedlib_static.a
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 37%] Built target edlib_static
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color=
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/DependInfo.cmake --color=
Scanning dependencies of target edlib-aligner
Scanning dependencies of target runTests
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 62%] Building CXX object CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o
[ 62%] Building CXX object CMakeFiles/runTests.dir/test/runTests.cpp.o
/usr/bin/c++   -I/<<PKGBUILDDIR>>/edlib/include  -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG   -std=c++11 -o CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -c /<<PKGBUILDDIR>>/apps/aligner/aligner.cpp
/usr/bin/c++   -I/<<PKGBUILDDIR>>/edlib/include  -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG   -std=c++11 -o CMakeFiles/runTests.dir/test/runTests.cpp.o -c /<<PKGBUILDDIR>>/test/runTests.cpp
[ 75%] Linking CXX shared library lib/libedlib.so
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib.dir/link.txt --verbose=1
/usr/bin/c++ -fPIC -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -shared -Wl,-soname,libedlib.so.0 -o lib/libedlib.so.1.2.3 CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o 
/usr/bin/cmake -E cmake_symlink_library lib/libedlib.so.1.2.3 lib/libedlib.so.0 lib/libedlib.so
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 75%] Built target edlib
/<<PKGBUILDDIR>>/apps/aligner/aligner.cpp: In function 'void printAlignment(const char*, const char*, const unsigned char*, int, int, EdlibAlignMode)':
/<<PKGBUILDDIR>>/apps/aligner/aligner.cpp:346:13: warning: 'startTIdx' may be used uninitialized in this function [-Wmaybe-uninitialized]
         int startTIdx;
             ^~~~~~~~~
[ 87%] Linking CXX executable bin/runTests
/usr/bin/cmake -E cmake_link_script CMakeFiles/runTests.dir/link.txt --verbose=1
/usr/bin/c++  -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG  -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/runTests.dir/test/runTests.cpp.o  -o bin/runTests lib/libedlib_static.a 
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 87%] Built target runTests
[100%] Linking CXX executable bin/edlib-aligner
/usr/bin/cmake -E cmake_link_script CMakeFiles/edlib-aligner.dir/link.txt --verbose=1
/usr/bin/c++  -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -pedantic -O3 -DNDEBUG  -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o  -o bin/edlib-aligner lib/libedlib_static.a 
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[100%] Built target edlib-aligner
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles 0
make[2]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
# /usr/bin/make --directory=bindings/python
/usr/bin/make --directory=bindings/python edlib pyedlib.bycython.cpp
make[2]: Entering directory '/<<PKGBUILDDIR>>/bindings/python'
cp -R ../../edlib .
cython3 --cplus edlib.pyx -o edlib.bycython.cpp
/usr/lib/python3/dist-packages/Cython/Compiler/Main.py:367: FutureWarning: Cython directive 'language_level' not set, using 2 for now (Py2). This will change in a later release! File: /<<PKGBUILDDIR>>/bindings/python/edlib.pyx
  tree = Parsing.p_module(s, pxd, full_module_name)
make[2]: Leaving directory '/<<PKGBUILDDIR>>/bindings/python'
dh_auto_build --buildsystem=pybuild -- --dir bindings/python
I: pybuild base:217: /usr/bin/python3 setup.py build 
running build
running build_ext
building 'edlib' extension
creating build
creating build/temp.linux-armhf-3.7
creating build/temp.linux-armhf-3.7/edlib
creating build/temp.linux-armhf-3.7/edlib/src
arm-linux-gnueabihf-gcc -pthread -DNDEBUG -g -fwrapv -O2 -Wall -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.7m -c edlib.bycython.cpp -o build/temp.linux-armhf-3.7/edlib.bycython.o -O3 -std=c++11
arm-linux-gnueabihf-gcc -pthread -DNDEBUG -g -fwrapv -O2 -Wall -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.7m -c edlib/src/edlib.cpp -o build/temp.linux-armhf-3.7/edlib/src/edlib.o -O3 -std=c++11
arm-linux-gnueabihf-g++ -pthread -shared -Wl,-O1 -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,relro -Wl,-z,now -g -O2 -fdebug-prefix-map=/<<PKGBUILDDIR>>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 build/temp.linux-armhf-3.7/edlib.bycython.o build/temp.linux-armhf-3.7/edlib/src/edlib.o -o /<<PKGBUILDDIR>>/.pybuild/cpython3_3.7_edlib/build/edlib.cpython-37m-arm-linux-gnueabihf.so
/usr/lib/python3/dist-packages/setuptools/dist.py:470: UserWarning: Normalizing '1.2.3-1' to '1.2.3.post1'
  normalized_version,
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   debian/rules override_dh_auto_test
make[1]: Entering directory '/<<PKGBUILDDIR>>'
`find . -name edlib-aligner -type f -executable` -p apps/aligner/test_data/query.fasta apps/aligner/test_data/target.fasta
Using NW alignment mode.
Reading queries...
Read 1 queries, 110 residues total.
Reading target fasta file...
Read target, 109 residues.

Comparing queries to target...

Query #0 (110 residues): score = 17
T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48)
   ||||||| |   |||||||||| |||||||||||||||||||||||||||
Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46)

T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92)
   | ||||||||||||   || ||||||||||  ||||||||| |||||| |
Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94)

T: AESIKSKKKKKE-STTB (93 - 108)
    ||||||||||| ||| 
Q: -ESIKSKKKKKENSTT- (94 - 109)


Cpu time of searching: 0.000553
`find . -name runTests`
Testing HW with alignment...
HW: 100/100 random tests passed!
Time Edlib: 0.412075
Time Simple: 1.749008
Times faster: 4.24

Testing HW...
HW: 100/100 random tests passed!
Time Edlib: 0.352947
Time Simple: 1.883516
Times faster: 5.34

Testing NW with alignment...
NW: 100/100 random tests passed!
Time Edlib: 0.860890
Time Simple: 1.989619
Times faster: 2.31

Testing NW...
NW: 100/100 random tests passed!
Time Edlib: 0.171609
Time Simple: 1.568592
Times faster: 9.14

Testing SHW with alignment...
SHW: 100/100 random tests passed!
Time Edlib: 0.046789
Time Simple: 1.646577
Times faster: 35.19

Testing SHW...
SHW: 100/100 random tests passed!
Time Edlib: 0.028992
Time Simple: 1.590851
Times faster: 54.87

Specific tests:
Test #0:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #1:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #2:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #3:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #4:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #5:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #6:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #7:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #8:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #9:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #10:
HW:   OK 
NW:   OK 
SHW:  OK 
Test #11:
OK
Test #12:
OK
Test #13:
OK
Test #14:
OK
Test #15:
OK
Test #16:
Cigar extended: OK
Cigar standard: OK
Test #17:
Degenerate nucleotides (HW): OK
All specific tests passed!
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   create-stamp debian/debhelper-build-stamp
 fakeroot debian/rules binary-arch
dh binary-arch --with python3
   dh_testroot -a
   dh_prep -a
   debian/rules override_dh_auto_install
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_auto_install --buildsystem=cmake
	cd obj-arm-linux-gnueabihf && make -j4 install DESTDIR=/<<PKGBUILDDIR>>/debian/tmp AM_UPDATE_INFO_DIR=no "INSTALL=install --strip-program=true"
make[2]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -S/<<PKGBUILDDIR>> -B/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/progress.marks
make -f CMakeFiles/Makefile2 all
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake --color=
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake --color=
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build
make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/edlib_static.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/edlib.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[ 50%] Built target edlib
[ 50%] Built target edlib_static
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/DependInfo.cmake --color=
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
cd /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /<<PKGBUILDDIR>> /<<PKGBUILDDIR>> /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color=
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build
make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/edlib-aligner.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[4]: Nothing to be done for 'CMakeFiles/runTests.dir/build'.
make[4]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
[100%] Built target edlib-aligner
[100%] Built target runTests
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
/usr/bin/cmake -E cmake_progress_start /<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf/CMakeFiles 0
make -f CMakeFiles/Makefile2 preinstall
make[3]: Entering directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
make[3]: Nothing to be done for 'preinstall'.
make[3]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
Install the project...
/usr/bin/cmake -P cmake_install.cmake
-- Install configuration: "Release"
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib.so.1.2.3
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib.so.0
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib.so
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib_static.a
-- Installing: /<<PKGBUILDDIR>>/debian/tmp/usr/include/edlib.h
make[2]: Leaving directory '/<<PKGBUILDDIR>>/obj-arm-linux-gnueabihf'
dh_auto_install --buildsystem=pybuild -- --dir bindings/python
I: pybuild base:217: /usr/bin/python3 setup.py install --root /<<PKGBUILDDIR>>/debian/python3-edlib 
running install
running build
running build_ext
running install_lib
creating /<<PKGBUILDDIR>>/debian/python3-edlib
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.7
creating /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.7/dist-packages
copying /<<PKGBUILDDIR>>/.pybuild/cpython3_3.7_edlib/build/edlib.cpython-37m-arm-linux-gnueabihf.so -> /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.7/dist-packages
running install_egg_info
running egg_info
creating edlib.egg-info
writing edlib.egg-info/PKG-INFO
writing dependency_links to edlib.egg-info/dependency_links.txt
writing top-level names to edlib.egg-info/top_level.txt
writing manifest file 'edlib.egg-info/SOURCES.txt'
reading manifest file 'edlib.egg-info/SOURCES.txt'
reading manifest template 'MANIFEST.in'
writing manifest file 'edlib.egg-info/SOURCES.txt'
Copying edlib.egg-info to /<<PKGBUILDDIR>>/debian/python3-edlib/usr/lib/python3.7/dist-packages/edlib-1.2.3.post1.egg-info
Skipping SOURCES.txt
running install_scripts
/usr/lib/python3/dist-packages/setuptools/dist.py:470: UserWarning: Normalizing '1.2.3-1' to '1.2.3.post1'
  normalized_version,
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   debian/rules override_dh_install
make[1]: Entering directory '/<<PKGBUILDDIR>>'
dh_install
file-rename 's/_static\.a/.a/' `find debian -name libedlib_static.a`
d-shlibmove --commit \
	    --multiarch \
	    --devunversioned \
	    --exclude-la \
	    --movedev debian/tmp/usr/include/* usr/include \
	    debian/tmp/usr/lib/*.so
Library package automatic movement utility
set -e
install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
install -d -m 755 debian/libedlib0/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/libedlib.a debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv debian/tmp/usr/lib/libedlib.so debian/libedlib-dev/usr/lib/arm-linux-gnueabihf
mv /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib.so.0 debian/libedlib0/usr/lib/arm-linux-gnueabihf
mv /<<PKGBUILDDIR>>/debian/tmp/usr/lib/libedlib.so.1.2.3 debian/libedlib0/usr/lib/arm-linux-gnueabihf
PKGDEV=libedlib-dev
PKGSHL=libedlib0
install -d -m 755 debian/libedlib-dev/usr/include
mv debian/tmp/usr/include/edlib.h debian/libedlib-dev/usr/include
make[1]: Leaving directory '/<<PKGBUILDDIR>>'
   dh_installdocs -a
   dh_installchangelogs -a
   dh_installexamples -a
   dh_installman -a
   dh_python3 -a
   dh_perl -a
   dh_link -a
   dh_strip_nondeterminism -a
   dh_compress -a
   dh_fixperms -a
   dh_missing -a
   dh_dwz -a
   dh_strip -a
   dh_makeshlibs -a
   dh_shlibdeps -a
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/edlib-aligner/usr/bin/edlib-aligner was not linked against ld-linux-armhf.so.3 (it uses none of the library's symbols)
dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/python3-edlib/usr/lib/python3/dist-packages/edlib.cpython-37m-arm-linux-gnueabihf.so was not linked against libpthread.so.0 (it uses none of the library's symbols)
   dh_installdeb -a
   dh_gencontrol -a
dpkg-gencontrol: warning: Depends field of package libedlib-dev: substitution variable ${shlibs:Depends} used, but is not defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined
dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined
   dh_md5sums -a
   dh_builddeb -a
dpkg-deb: building package 'libedlib-dev' in '../libedlib-dev_1.2.4-1_armhf.deb'.
dpkg-deb: building package 'libedlib0' in '../libedlib0_1.2.4-1_armhf.deb'.
dpkg-deb: building package 'edlib-aligner-dbgsym' in '../edlib-aligner-dbgsym_1.2.4-1_armhf.deb'.
dpkg-deb: building package 'python3-edlib-dbgsym' in '../python3-edlib-dbgsym_1.2.4-1_armhf.deb'.
dpkg-deb: building package 'libedlib0-dbgsym' in '../libedlib0-dbgsym_1.2.4-1_armhf.deb'.
dpkg-deb: building package 'edlib-aligner' in '../edlib-aligner_1.2.4-1_armhf.deb'.
dpkg-deb: building package 'python3-edlib' in '../python3-edlib_1.2.4-1_armhf.deb'.
 dpkg-genbuildinfo --build=any
 dpkg-genchanges --build=any -mRaspbian wandboard test autobuilder <root@raspbian.org> >../libedlib_1.2.4-1_armhf.changes
dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included)
 dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
--------------------------------------------------------------------------------
Build finished at 2019-01-31T05:43:49Z

Finished
--------

I: Built successfully

+------------------------------------------------------------------------------+
| Post Build Chroot                                                            |
+------------------------------------------------------------------------------+


+------------------------------------------------------------------------------+
| Changes                                                                      |
+------------------------------------------------------------------------------+


libedlib_1.2.4-1_armhf.changes:
-------------------------------

Format: 1.8
Date: Mon, 28 Jan 2019 19:11:07 +0100
Source: libedlib
Binary: libedlib0 libedlib-dev edlib-aligner python3-edlib
Architecture: armhf
Version: 1.2.4-1
Distribution: buster-staging
Urgency: medium
Maintainer: Raspbian wandboard test autobuilder <root@raspbian.org>
Changed-By: Andreas Tille <tille@debian.org>
Description:
 edlib-aligner - edlib sequence alignment tool using edit distance
 libedlib-dev - library for sequence alignment using edit distance (devel)
 libedlib0  - library for sequence alignment using edit distance
 python3-edlib - library for sequence alignment using edit distance (Python3 modul
Changes:
 libedlib (1.2.4-1) unstable; urgency=medium
 .
   * New upstream version
   * debhelper 12
   * Standards-Version: 4.3.0
Checksums-Sha1:
 e39b2f1c450882c9f6477ba869e75c853904f173 123648 edlib-aligner-dbgsym_1.2.4-1_armhf.deb
 58a51e53a912f9a4f3db1928e867d185b663127e 19912 edlib-aligner_1.2.4-1_armhf.deb
 4ce89ceb6e10856e6b3c8c2b6c98d66747fb3ce3 16200 libedlib-dev_1.2.4-1_armhf.deb
 491b29ba112cac840b1c346e4d2108b2633e7a8f 82084 libedlib0-dbgsym_1.2.4-1_armhf.deb
 2b5d15fcbc361234bb4868935b0ef564fd7f8ac5 14140 libedlib0_1.2.4-1_armhf.deb
 7fe84837fa0dde2524c4c102ed703f86c1bbfbc3 8271 libedlib_1.2.4-1_armhf.buildinfo
 70e795c9c4dd56e4e1056a051ca6de4f9d50de69 144264 python3-edlib-dbgsym_1.2.4-1_armhf.deb
 ec649936725286d646c56430d695480a02cde613 28508 python3-edlib_1.2.4-1_armhf.deb
Checksums-Sha256:
 5af9c399d3e959201d52a38059869a560a4ef4424496eda2cf7f53be82ab0c90 123648 edlib-aligner-dbgsym_1.2.4-1_armhf.deb
 cb0513dbeb8df5882ebf5c8a45bd8df3b56aedf26ab2744fb1b817b3840815f9 19912 edlib-aligner_1.2.4-1_armhf.deb
 3db133eb0bcfd5ef937bea805f908b98e78b25467a49375176111e477170724c 16200 libedlib-dev_1.2.4-1_armhf.deb
 15efb03dda102eb80ceec0c9671115b17a41a867c41014581a6c48e848441140 82084 libedlib0-dbgsym_1.2.4-1_armhf.deb
 d12ed6ec932a72f33b5db905443b12102e2184b68db2454e3a7e7b95cd6f90b5 14140 libedlib0_1.2.4-1_armhf.deb
 fca796ee681ab94b4b38886c4fe8dae53b953172e2e1e4e40b14986ba9d7a5cb 8271 libedlib_1.2.4-1_armhf.buildinfo
 0554218e44592742d8c6d0adf40e5c752a2cb0daf8c38b221bc4e9b408a4eeed 144264 python3-edlib-dbgsym_1.2.4-1_armhf.deb
 72c708009af5405d9386d27cd5cc587183a69a1603ac820aca77fedf51d2327f 28508 python3-edlib_1.2.4-1_armhf.deb
Files:
 89c741082eb0837bc3aae62dd1066422 123648 debug optional edlib-aligner-dbgsym_1.2.4-1_armhf.deb
 12692e0f71b5afee9262e3d640736b65 19912 science optional edlib-aligner_1.2.4-1_armhf.deb
 3906b0386aabedfbcf5e2eb69fc6c419 16200 libdevel optional libedlib-dev_1.2.4-1_armhf.deb
 d435543e1c6507c2368f4952000ae7c3 82084 debug optional libedlib0-dbgsym_1.2.4-1_armhf.deb
 b539c230b7d6bacbfb3e8f28cf0aeda0 14140 libs optional libedlib0_1.2.4-1_armhf.deb
 62a2beeb0737573122d502b9852d8207 8271 science optional libedlib_1.2.4-1_armhf.buildinfo
 ce76fa777cf7cf2780100f3f86cb0ffc 144264 debug optional python3-edlib-dbgsym_1.2.4-1_armhf.deb
 29d14e14458ffe3d2bf044365cf3c740 28508 python optional python3-edlib_1.2.4-1_armhf.deb

+------------------------------------------------------------------------------+
| Package contents                                                             |
+------------------------------------------------------------------------------+


edlib-aligner-dbgsym_1.2.4-1_armhf.deb
--------------------------------------

 new Debian package, version 2.0.
 size 123648 bytes: control archive=544 bytes.
     389 bytes,    12 lines      control              
     106 bytes,     1 lines      md5sums              
 Package: edlib-aligner-dbgsym
 Source: libedlib
 Version: 1.2.4-1
 Auto-Built-Package: debug-symbols
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 135
 Depends: edlib-aligner (= 1.2.4-1)
 Section: debug
 Priority: optional
 Description: debug symbols for edlib-aligner
 Build-Ids: 4ceddf665a940b4dde766dec661a30f04e1f59ab

drwxr-xr-x root/root         0 2019-01-28 18:11 ./
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/debug/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/debug/.build-id/4c/
-rw-r--r-- root/root    127544 2019-01-28 18:11 ./usr/lib/debug/.build-id/4c/eddf665a940b4dde766dec661a30f04e1f59ab.debug
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/
lrwxrwxrwx root/root         0 2019-01-28 18:11 ./usr/share/doc/edlib-aligner-dbgsym -> edlib-aligner


edlib-aligner_1.2.4-1_armhf.deb
-------------------------------

 new Debian package, version 2.0.
 size 19912 bytes: control archive=1284 bytes.
    1414 bytes,    31 lines      control              
     545 bytes,     7 lines      md5sums              
 Package: edlib-aligner
 Source: libedlib
 Version: 1.2.4-1
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 56
 Depends: libc6 (>= 2.4), libgcc1 (>= 1:3.5), libstdc++6 (>= 5.2), libedlib0 (= 1.2.4-1)
 Section: science
 Priority: optional
 Homepage: https://github.com/Martinsos/edlib
 Description: edlib sequence alignment tool using edit distance
  Edlib is a lightweight and super fast C/C++ library for sequence
  alignment using edit distance.  This package provides an aligner
  using this library.
  .
  Features of libedlib
  .
   * Calculates edit distance (Levehnstein distance).
   * It can find optimal alignment path (instructions how to transform
     first sequence into the second sequence).
   * It can find just the start and/or end locations of alignment path -
     can be useful when speed is more important than having exact
     alignment path.
   * Supports multiple alignment methods: global(NW), prefix(SHW) and
     infix(HW), each of them useful for different scenarios.
   * You can extend character equality definition, enabling you to e.g.
     have wildcard characters, to have case insensitive alignment or to
     work with degenerate nucleotides.
   * It can easily handle small or very large sequences, even when finding
     alignment path, while consuming very little memory.
   * Super fast thanks to Myers's bit-vector algorithm.

drwxr-xr-x root/root         0 2019-01-28 18:11 ./
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/bin/
-rwxr-xr-x root/root     38408 2019-01-28 18:11 ./usr/bin/edlib-aligner
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/edlib-aligner/
-rw-r--r-- root/root       437 2019-01-28 18:11 ./usr/share/doc/edlib-aligner/changelog.Debian.gz
-rw-r--r-- root/root      1343 2019-01-28 18:11 ./usr/share/doc/edlib-aligner/copyright
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/edlib-aligner/examples/
drwxr-xr-x root/root         0 2019-01-20 19:31 ./usr/share/doc/edlib-aligner/examples/test_data/
-rw-r--r-- root/root       112 2019-01-20 19:31 ./usr/share/doc/edlib-aligner/examples/test_data/query.fasta
-rw-r--r-- root/root       111 2019-01-20 19:31 ./usr/share/doc/edlib-aligner/examples/test_data/target.fasta
-rw-r--r-- root/root       334 2019-01-28 18:11 ./usr/share/doc/edlib-aligner/run-unit-test
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/man/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/man/man1/
-rw-r--r-- root/root       815 2019-01-28 18:11 ./usr/share/man/man1/edlib-aligner.1.gz


libedlib-dev_1.2.4-1_armhf.deb
------------------------------

 new Debian package, version 2.0.
 size 16200 bytes: control archive=1220 bytes.
    1511 bytes,    36 lines      control              
     279 bytes,     4 lines      md5sums              
 Package: libedlib-dev
 Source: libedlib
 Version: 1.2.4-1
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 51
 Depends: libedlib0 (= 1.2.4-1)
 Section: libdevel
 Priority: optional
 Homepage: https://github.com/Martinsos/edlib
 Description: library for sequence alignment using edit distance (devel)
  A lightweight and super fast C/C++ library for sequence alignment using
  edit distance.
  .
  Calculating edit distance of two strings is as simple as:
  .
   edlibAlign("hello", 5, "world!", 6,
              edlibDefaultAlignConfig()).editDistance;
  Features
  .
   * Calculates edit distance (Levehnstein distance).
   * It can find optimal alignment path (instructions how to transform
     first sequence into the second sequence).
   * It can find just the start and/or end locations of alignment path -
     can be useful when speed is more important than having exact
     alignment path.
   * Supports multiple alignment methods: global(NW), prefix(SHW) and
     infix(HW), each of them useful for different scenarios.
   * You can extend character equality definition, enabling you to e.g.
     have wildcard characters, to have case insensitive alignment or to
     work with degenerate nucleotides.
   * It can easily handle small or very large sequences, even when finding
     alignment path, while consuming very little memory.
   * Super fast thanks to Myers's bit-vector algorithm.
  .
  This package contains the static library and the header files.

drwxr-xr-x root/root         0 2019-01-28 18:11 ./
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/include/
-rw-r--r-- root/root     10702 2019-01-20 19:31 ./usr/include/edlib.h
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/arm-linux-gnueabihf/
-rw-r--r-- root/root     26982 2019-01-28 18:11 ./usr/lib/arm-linux-gnueabihf/libedlib.a
lrwxrwxrwx root/root         0 2019-01-28 18:11 ./usr/lib/arm-linux-gnueabihf/libedlib.so -> libedlib.so.0
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/libedlib-dev/
-rw-r--r-- root/root       437 2019-01-28 18:11 ./usr/share/doc/libedlib-dev/changelog.Debian.gz
-rw-r--r-- root/root      1343 2019-01-28 18:11 ./usr/share/doc/libedlib-dev/copyright


libedlib0-dbgsym_1.2.4-1_armhf.deb
----------------------------------

 new Debian package, version 2.0.
 size 82084 bytes: control archive=536 bytes.
     376 bytes,    12 lines      control              
     106 bytes,     1 lines      md5sums              
 Package: libedlib0-dbgsym
 Source: libedlib
 Version: 1.2.4-1
 Auto-Built-Package: debug-symbols
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 93
 Depends: libedlib0 (= 1.2.4-1)
 Section: debug
 Priority: optional
 Description: debug symbols for libedlib0
 Build-Ids: 4086a8ec5d2d2345c25601bcc4dd97d6493978a2

drwxr-xr-x root/root         0 2019-01-28 18:11 ./
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/debug/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/debug/.build-id/40/
-rw-r--r-- root/root     84556 2019-01-28 18:11 ./usr/lib/debug/.build-id/40/86a8ec5d2d2345c25601bcc4dd97d6493978a2.debug
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/
lrwxrwxrwx root/root         0 2019-01-28 18:11 ./usr/share/doc/libedlib0-dbgsym -> libedlib0


libedlib0_1.2.4-1_armhf.deb
---------------------------

 new Debian package, version 2.0.
 size 14140 bytes: control archive=1532 bytes.
    1509 bytes,    36 lines      control              
     226 bytes,     3 lines      md5sums              
      32 bytes,     1 lines      shlibs               
     582 bytes,    10 lines      symbols              
      63 bytes,     2 lines      triggers             
 Package: libedlib0
 Source: libedlib
 Version: 1.2.4-1
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 41
 Depends: libc6 (>= 2.4), libgcc1 (>= 1:3.5), libstdc++6 (>= 5.2)
 Section: libs
 Priority: optional
 Homepage: https://github.com/Martinsos/edlib
 Description: library for sequence alignment using edit distance
  A lightweight and super fast C/C++ library for sequence alignment using
  edit distance.
  .
  Calculating edit distance of two strings is as simple as:
  .
   edlibAlign("hello", 5, "world!", 6,
              edlibDefaultAlignConfig()).editDistance;
  Features
  .
   * Calculates edit distance (Levehnstein distance).
   * It can find optimal alignment path (instructions how to transform
     first sequence into the second sequence).
   * It can find just the start and/or end locations of alignment path -
     can be useful when speed is more important than having exact
     alignment path.
   * Supports multiple alignment methods: global(NW), prefix(SHW) and
     infix(HW), each of them useful for different scenarios.
   * You can extend character equality definition, enabling you to e.g.
     have wildcard characters, to have case insensitive alignment or to
     work with degenerate nucleotides.
   * It can easily handle small or very large sequences, even when finding
     alignment path, while consuming very little memory.
   * Super fast thanks to Myers's bit-vector algorithm.
  .
  This package contains the shared library.

drwxr-xr-x root/root         0 2019-01-28 18:11 ./
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/arm-linux-gnueabihf/
lrwxrwxrwx root/root         0 2019-01-28 18:11 ./usr/lib/arm-linux-gnueabihf/libedlib.so.0 -> libedlib.so.1.2.3
-rw-r--r-- root/root     25960 2019-01-28 18:11 ./usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.3
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/libedlib0/
-rw-r--r-- root/root       437 2019-01-28 18:11 ./usr/share/doc/libedlib0/changelog.Debian.gz
-rw-r--r-- root/root      1343 2019-01-28 18:11 ./usr/share/doc/libedlib0/copyright


python3-edlib-dbgsym_1.2.4-1_armhf.deb
--------------------------------------

 new Debian package, version 2.0.
 size 144264 bytes: control archive=540 bytes.
     389 bytes,    12 lines      control              
     106 bytes,     1 lines      md5sums              
 Package: python3-edlib-dbgsym
 Source: libedlib
 Version: 1.2.4-1
 Auto-Built-Package: debug-symbols
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 160
 Depends: python3-edlib (= 1.2.4-1)
 Section: debug
 Priority: optional
 Description: debug symbols for python3-edlib
 Build-Ids: 15c4dd6d55a538178c1027d0f28dd33163e5eb38

drwxr-xr-x root/root         0 2019-01-28 18:11 ./
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/debug/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/debug/.build-id/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/debug/.build-id/15/
-rw-r--r-- root/root    153116 2019-01-28 18:11 ./usr/lib/debug/.build-id/15/c4dd6d55a538178c1027d0f28dd33163e5eb38.debug
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/
lrwxrwxrwx root/root         0 2019-01-28 18:11 ./usr/share/doc/python3-edlib-dbgsym -> python3-edlib


python3-edlib_1.2.4-1_armhf.deb
-------------------------------

 new Debian package, version 2.0.
 size 28508 bytes: control archive=1368 bytes.
    1569 bytes,    36 lines      control              
     576 bytes,     6 lines      md5sums              
 Package: python3-edlib
 Source: libedlib
 Version: 1.2.4-1
 Architecture: armhf
 Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
 Installed-Size: 82
 Depends: libc6 (>= 2.4), libgcc1 (>= 1:3.5), libstdc++6 (>= 5.2), python3 (<< 3.8), python3 (>= 3.7~)
 Section: python
 Priority: optional
 Homepage: https://github.com/Martinsos/edlib
 Description: library for sequence alignment using edit distance (Python3 module)
  A lightweight and super fast C/C++ library for sequence alignment using
  edit distance.
  .
  Calculating edit distance of two strings is as simple as:
  .
   edlibAlign("hello", 5, "world!", 6,
              edlibDefaultAlignConfig()).editDistance;
  Features
  .
   * Calculates edit distance (Levehnstein distance).
   * It can find optimal alignment path (instructions how to transform
     first sequence into the second sequence).
   * It can find just the start and/or end locations of alignment path -
     can be useful when speed is more important than having exact
     alignment path.
   * Supports multiple alignment methods: global(NW), prefix(SHW) and
     infix(HW), each of them useful for different scenarios.
   * You can extend character equality definition, enabling you to e.g.
     have wildcard characters, to have case insensitive alignment or to
     work with degenerate nucleotides.
   * It can easily handle small or very large sequences, even when finding
     alignment path, while consuming very little memory.
   * Super fast thanks to Myers's bit-vector algorithm.
  .
  This package contains the Python3 module.

drwxr-xr-x root/root         0 2019-01-28 18:11 ./
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/python3/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/python3/dist-packages/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/lib/python3/dist-packages/edlib-1.2.3.post1.egg-info/
-rw-r--r-- root/root      5744 2019-01-28 18:11 ./usr/lib/python3/dist-packages/edlib-1.2.3.post1.egg-info/PKG-INFO
-rw-r--r-- root/root         1 2019-01-28 18:11 ./usr/lib/python3/dist-packages/edlib-1.2.3.post1.egg-info/dependency_links.txt
-rw-r--r-- root/root         6 2019-01-28 18:11 ./usr/lib/python3/dist-packages/edlib-1.2.3.post1.egg-info/top_level.txt
-rw-r--r-- root/root     61692 2019-01-28 18:11 ./usr/lib/python3/dist-packages/edlib.cpython-37m-arm-linux-gnueabihf.so
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/
drwxr-xr-x root/root         0 2019-01-28 18:11 ./usr/share/doc/python3-edlib/
-rw-r--r-- root/root       437 2019-01-28 18:11 ./usr/share/doc/python3-edlib/changelog.Debian.gz
-rw-r--r-- root/root      1343 2019-01-28 18:11 ./usr/share/doc/python3-edlib/copyright


+------------------------------------------------------------------------------+
| Post Build                                                                   |
+------------------------------------------------------------------------------+


+------------------------------------------------------------------------------+
| Cleanup                                                                      |
+------------------------------------------------------------------------------+

Purging /<<BUILDDIR>>
Not cleaning session: cloned chroot in use

+------------------------------------------------------------------------------+
| Summary                                                                      |
+------------------------------------------------------------------------------+

Build Architecture: armhf
Build-Space: 19824
Build-Time: 138
Distribution: buster-staging
Host Architecture: armhf
Install-Time: 597
Job: libedlib_1.2.4-1
Machine Architecture: armhf
Package: libedlib
Package-Time: 787
Source-Version: 1.2.4-1
Space: 19824
Status: successful
Version: 1.2.4-1
--------------------------------------------------------------------------------
Finished at 2019-01-31T05:43:49Z
Build needed 00:13:07, 19824k disc space